Recombinant Mouse Leukocyte surface antigen CD47(Cd47),partial (Active)

In Stock
Code CSB-AP005351MO
Product Type Immune Checkpoint
Size $124Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q61735
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by its ability to bind Mouse SIRPA in functional ELISA is less than 20 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP
Research Area Cancer
Source Mammalian cell
Gene Names Cd47
Expression Region 19-158aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 16.7 kDa
Protein Description Partial of Isoform 2
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: mmu:16423

UniGene: Mm.31752

Related Products

Cd47 Proteins

Cd47 Proteins for Mus musculus (Mouse)

Cd47 ELISA Kit

Cd47 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.