Recombinant Mouse Leukocyte surface antigen CD47(Cd47),partial (Active)

In Stock
Code CSB-AP005351MO
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to bind Mouse SIRPA in functional ELISA is less than 20 ug/ml.
Target Names Cd47
Uniprot No. Q61735
Research Area Cancer
Alternative Names Cd47Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47
Species Mus musculus (Mouse)
Source Mammalian cell
Expression Region 19-158aa
Complete Sequence QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP
Mol. Weight 16.7 kDa
Protein Length Partial of Isoform 2
Tag Info C-terminal 6xHis-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection (By similarity).
Gene References into Functions
  1. this study shows that inhibition of IAP represses inflammatory status via nuclear factor-kappa B pathway in murine endometriosis lesions PMID: 29105884
  2. Our results support an intrinsic role of CD47 in ovarian cancer progression and immune evasion PMID: 28380460
  3. mice deficient in CD47 (CD47 Knockout) had significantly less brain neutrophil infiltration at 24h, upregulated VEGF expression in peri-lesion cortex at 7 and 14day PMID: 27931776
  4. TSP1 significantly accelerates replicative senescence and associated cell cycle arrest in a CD47-dependent manner. PMID: 27607583
  5. CD47, TSP1, and to a lesser extent SIRPalpha facilitate exosome-mediated myeloid-derived suppressor cells chemotaxis and migration. PMID: 27728760
  6. In pulmonary hypertension TSP1-CD47 is upregulated, and contributes to pulmonary arterial vasculopathy and dysfunction. PMID: 27742621
  7. thrombospondin-1 via CD47 inhibits renal tubular epithelial cell recovery after ischemia reperfusion injury through inhibition of proliferation/self-renewal. PMID: 27259369
  8. these findings have demonstrated how tumor cells inhibit innate sensing in dendritic cells and suggested that the CD47-SIRPalpha axis is critical for dendritic cell-driven antitumor immunity PMID: 28801234
  9. this study shows that CD47 deficiency in tumor stroma promotes tumor progression by enhancing angiogenesis PMID: 27283989
  10. the results obtained by combining bioinformatics and preclinical studies strongly suggest that targeting TSP-1/CD47 axis may represent a valuable therapeutic alternative for hampering melanoma spreading. PMID: 27349907
  11. Treg cells protect dopaminergic neurons against MPP+ neurotoxicity by a cell-to-cell contact mechanism underlying CD47-SIRPA interaction and Rac1/Akt activation. PMID: 28268219
  12. CD47 deficient mice with vaccination showed greater protective efficacy against lethal challenge. PMID: 27194758
  13. These results indicate an important role for CD47-SIRPalpha interactions in innate control of malaria and suggest novel targets for intervention. PMID: 27091932
  14. atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule that is known to render malignant cells resistant to programmed cell removal, or 'efferocytosis' PMID: 27437576
  15. Erythrocyte CD47 has a key role in hematoma clearance after intracerebral hemorrhage. PMID: 26732568
  16. These data indicate that CD47 plays protective roles against disseminated candidiasis and alters pro-inflammatory and immunosuppressive pathways known to regulate innate and T cell immunity. PMID: 26010544
  17. CD47 deficiency ameliorates lupus nephritis in Fas(lpr) mice via suppression of IgG autoantibody production. PMID: 26095930
  18. the cell adhesion molecule CD47 participates in multiple phases of granule cell development, including proliferation, migration, and neurite differentiation PMID: 25288019
  19. CD47 mediates signaling from the extracellular matrix that coordinately regulates basal metabolism and cytoprotective responses to radiation injury PMID: 26311851
  20. Taken together, these data revealed a novel role for CD47 in the development of obesity and its related metabolic complications. PMID: 25747123
  21. NF KB mediated CD47 up regulation promotes sorafenib resistance treating hepatocellular carcinoma. PMID: 25902734
  22. Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages. PMID: 26085683
  23. findings prove that the TSP-1/CD47/SIRP-alpha signal axis is important to the evolution of tumor cells in the microenvironment of immunotherapy and identify thrombospondin-1 as a key signal PMID: 25697354
  24. Thrombospondin-1 and CD47 signaling regulate healing of thermal injury in mice. PMID: 24840925
  25. the microglial proinflammatory response to Abeta(1-42) protofibril is not dependent on CD47 PMID: 25451248
  26. CD47 expression in the microenvironment was sufficient to limit tumor radiosensitivity. PMID: 25297630
  27. role in promoting left ventricular heart failure by CaKMII-mediated up-regulation of HDAC3 PMID: 24922625
  28. Polymorphism in the innate immune receptor SIRPalpha controls CD47 binding and autoimmunity in the nonobese diabetic mouse. PMID: 25305319
  29. using a syngeneic mouse hepatocyte transplantation model, the present study demonstrates that missing CD47 on donor cells alone can cause recipient myeloid cell activation and graft loss. PMID: 23394628
  30. sought to investigate the effect of Hsp70-peptide complex on the expression of CD172alpha and CD47 receptors in normal peritoneal macrophages (NMO) PMID: 24684700
  31. CD47 plays the pivotal role in the immune evasion of primary effusion lymphoma cells in body cavities. Therapeutic antibody targeting of CD47 could be an effective therapy for PEL. PMID: 24726056
  32. 'clustering' SIRPalpha into plasma membrane microdomains is essential for activated monocytes and macrophages to effectively interact with CD47 and initiate intracellular signaling PMID: 24143245
  33. Thrombospondin-1 signaling through CD47 is the first identified endogenous inhibitor of H2S signaling and constitutes a novel mechanism that negatively regulates T cell activation. PMID: 23499828
  34. Data indicate that lack of CD47 strongly impairs SIRPalpha-dependent osteoblast differentiation, deteriorate bone formation, and cause reduced formation of osteoclasts. PMID: 23990469
  35. Thus, CD47 antagonists enable cell self-renewal and reprogramming by overcoming negative regulation of c-Myc and other stem cell transcription factors. PMID: 23591719
  36. CD47 deficiency confers cell survival through the activation of autophagic flux and identifies CD47 blockade as a pharmacological route to modulate autophagy for protecting tissue from radiation injury. PMID: 22874555
  37. Inhibitor of apoptosis proteins (IAPs) and their antagonists regulate spontaneous and tumor necrosis factor (TNF)-induced proinflammatory cytokine and chemokine production PMID: 23275336
  38. CD47 deficiency promotes nerve fiber growth from cultured ventral mesencephalic dopamine neurons. PMID: 23049778
  39. Although polymorphonuclear neutrophil (PMN) transmigration is not delayed in CD47-deficient mice, fewer neutrophils are found in the intestine at the postacute/chronic stage of chronic colitis. PMID: 23203922
  40. CD47(low) status on CD4 effectors is necessary for the contraction/resolution of the immune response in humans and mice. PMID: 22870271
  41. Thrombospondin-1 regulates blood flow via CD47 receptor-mediated activation of NADPH oxidase 1. PMID: 23087362
  42. ectopic expression of murine Cd47 in human hepatocytes selectively favors engraftment upon transplantation into mice, a finding that should have a profound impact on the generation of robust humanized small animal models. PMID: 22535707
  43. Activation of parenchymal CD47 promotes renal ischemia-reperfusion injury. PMID: 22859854
  44. Engagement of endothelial CD47 by its ligands triggers outside-in signals in endothelium, facilitating leukocyte transendothelial migration at sites of inflammation. PMID: 22815286
  45. Data show that CD47(-/-) mice are refractory to experimental autoimmune encephalomyelitis (EAE). PMID: 22734047
  46. Activated CD47 promotes pulmonary arterial hypertension through targeting caveolin-1. PMID: 22215724
  47. CD47(high) status on CD4 T cells identifies functional long-lived memory T cell progenitors. PMID: 22461697
  48. CD47 signalling is dispensable for oral tolerance induction, whereas the expression of CD47 by non-haematopoietic cells is required for intestinal IgA B-cell responses. PMID: 22070457
  49. provides a rational basis for targeting CD47-SIRPalpha interactions, using for instance the antagonistic antibodies against human SIRPalpha described herein, to potentiate the clinical effects of cancer therapeutic antibodies PMID: 22042861
  50. CD47 deletion improves functional recovery from spinal cord injury via an increase in vascular patency, functional locomotor improvements and greater white matter sparing. PMID: 21168495
  51. Disrupting the CD47-SHPS-1 association leads to imapired osteoclastogenesis. PMID: 21638321
  52. Sensing of cell surface CD47 expression by phagocyte SIRPalpha is a critical determinant of T- and natural killer-cell homeostasis under steady-state conditions in vivo. PMID: 21788504
  53. SIRPalpha as well as its ligand CD47 are essential for steady-state homeostasis of T cells in the spleen. PMID: 21632712
  54. Loss of signaling from the TSP1-CD47 system promotes accumulation of normally functioning mitochondria in a tissue-specific and age-dependent fashion leading to enhanced physical performance, lower ROS production and more efficient metabolism. PMID: 21256215
  55. Amyloid-beta inhibits No-cGMP signaling in a CD36- and CD47-dependent manner PMID: 21203512
  56. Data show that myelin down-regulates its own phagocytosis through CD47-SIRPalpha interactions. PMID: 21401967
  57. Thrombospondin-1 inhibits VEGF receptor-2 signaling by disrupting its association with CD47 PMID: 20923780
  58. involved in autoimmune diabetes susceptibility PMID: 20138735
  59. Suppression of CD47 expression in newborn mice protects the animals from Escherichia coli K1-induced meningitis. PMID: 20675593
  60. data implicate that the role of CD47 in xenograft rejection may differ for different types of xenografts, and that CD47 incompatibility is unlikely to impede thymic xenotransplantation PMID: 20522249
  61. Inhibition of engulfment correlates with affinity of CD47 for SIRPA - but only at low levels of CD47. PMID: 20299253
  62. CD47 on donor cells is required to repress recipient DC activation and suppress allograft rejection after donor-specific transfusion PMID: 20208011
  63. platelet CD47 down-regulation may be a novel mechanism underneath STEC-induced platelet depletion, and the interactions between CD47 and its receptor, signal regulatory protein alpha (SIRPalpha), play an essential role in modulating platelet homeostasis PMID: 19771158
  64. CD47 expressed on platelets significantly contributes to platelet adhesion on tumor necrosis factor-alpha (TNF-alpha)-stimulated vascular endothelial cells PMID: 12609828
  65. Macrophages require CD47 and phosphatidylserine on apoptotic cells for phagocytic engulfment. PMID: 14634079
  66. CD47 binds to and thereby down-regulates SHPS-1 on adjacent cells, resulting in inhibition of cell motility PMID: 14739297
  67. inhibitory CD47/SIRPalpha signaling is involved in regulating platelet phagocytosis in immune thrombocytopenia PMID: 15665111
  68. Differential localization of SHPS-1 and CD47 at axons and dendrites, respectively, generates a directional intercellular communication system that potentially contributes to regulation of synaptogenesis and the formation of neural networks. PMID: 15758180
  69. Novel cd47-dependent intercellular adhesion modulates cell movement. PMID: 15880429
  70. CD47 associates with Fas upon its activation and augments Fas-mediated apoptosis. PMID: 15917238
  71. CD47 engagement in vivo significantly inhibits the emigration of LCs from the epidermis into draining lymph nodes following treatment with haptens and tumor necrosis factor-alpha. PMID: 16456531
  72. Review. Extensive studies in murine systems have shown that CD47 on erythrocytes and other cells can function as a regulator of target cell phagocytosis, by binding to the inhibitory receptor SIRPalpha on macrophages. PMID: 16564725
  73. CD47 on RBCs plays role in the negative regulation of phagocytosis by macrophages and in determination of the life span of circulating RBCs. PMID: 16580635
  74. Mouse RBCs but not human tend to aggregate due to cross-bridging by SIRPalpha complexes, showing accumulation of CD47 in the adhesion zone, which is consistent with a high mobility of CD47 unique to mu-RBC. PMID: 16581280
  75. CD47 demonstrates a fundamental role in dendritic cell migration in vivo and in vitro and in the function of marginal zone dendritic cells. PMID: 16670282
  76. highlight major species differences in CD47-SIRPalpha interactions and CD47 integration, suggesting that signaling by CD47 in man may be qualitatively different from mouse. PMID: 16697668
  77. Data show that ligation of either CD36 or CD47 can inhibit nitric oxide-stimulated vascular cell responses and cGMP signaling, but only CD47 is necessary for this activity of thrombospondin-1 at physiological concentrations. PMID: 16835222
  78. Our data reveal that CD47 on DCs is a critical factor in controlling migration and efficient initiation of the immune response. PMID: 17093498
  79. may have relevance for transfusion of stored RBCs, where loss of CD47 is seen over time, and in clearance of these cells by antibody-dependent phagocytosis PMID: 17112468
  80. We conclude that the CD47/SIRPalpha interaction is important for M-CSF/RANKL-stimulated osteoclast formation both in vivo and in vitro, and that absence of CD47 results in decreased numbers of osteoclasts in CD47-/- mice. PMID: 17126807
  81. CD47 promotes development of dendrites and axons in hippocampal neurons in a manner dependent, at least in part, on activation of Cdc42 and Rac mediated by Src as well as by FRG and Vav2. PMID: 17135401
  82. CD47 is the necessary receptor for limiting nitric oxide-mediated vascular smooth muscle relaxation and tissue survival following ischemic injury. PMID: 17293482
  83. These results reveal an important role in vivo for this new CD47/BNIP3 pathway in limiting inflammation by controlling the number of activated T cells. PMID: 17442977
  84. the importance of CD47 varies with cell type, since ligation of CD47 is not necessary for SIRPalpha phosphorylation in myeloid cells, whereas it is required in endothelial cells. PMID: 17584740
  85. macrophages in the latter chimeras retain phagocytic activity against CD47(null) RBCs PMID: 17699632
  86. provide supportive evidence for a role of decreasing CD47 expression on aging circulating red blood cells in their destruction by macrophages PMID: 17725740
  87. With increasing age and diet-induced atherosclerotic vascular disease, TSP1 and its receptor CD47 become more limiting for blood flow and tissue survival after ischemic injury. PMID: 17916772
  88. deficiency of CD47 protects mice from LPS-induced acute lung injury and E. coli pneumonia. PMID: 18453616
  89. transmigration of murine wild-type Th1 cells across TNF-alpha-activated murine CD47(-/-) endothelium was reduced by 75% PMID: 18524990
  90. Despite this, FcgammaR-mediated phagocytosis of IgG-opsonized Ox-RBCs was strongly inhibited by CD47 PMID: 18779391
  91. Both thrombospondin-1- and CD47-dependent radiosensitization is cell autonomous because vascular cells isolated from the respective null mice showed dramatically increased survival and improved proliferative capacity after irradiation in vitro. PMID: 18787106
  92. the presynaptic organizing activity of SIRP-alpha is distinct from FGF22 and is mediated in part by CD47 and its homologues, SIRP-beta and -gamma also have synaptic vesicle clustering activity PMID: 18819922
  93. reduced proportion of thymic dendritic cells expressing CD172a in CD47-deficient mice PMID: 19147837
  94. This study concluded that CD47 is broadly involved in neuroinflammation, and this integrin-associated-protein plays a role in promoting MMP-9 upregulaton, neutrophil extravasation, brain swelling and progression of acute ischemic brain injury. PMID: 19233173
  95. Thrombospondin-1 and its receptor CD47 serve as acute physiological regulators of blood pressure and exert a vasopressor activity to maintain global hemodynamics under stress. PMID: 19284971
  96. CD47 signaling can negatively affect the viability and function of cerebral endothelial cells, further supporting the notion that CD47 may be a potential neurovascular target for stroke and brain injury PMID: 19360900
  97. CD47 does not inhibit, but rather support, both phosphatidylserine (PS)-independent and PS-dependent uptake of apoptotic cells in the murine system. This mechanism only comes into play in non-activated macrophages. PMID: 19559673
  98. CD47 plays a role in the development of experimental colitis mediated by SIRPalpha+CD103- dendritic cells. PMID: 19703989
  99. Activation of CD47 signaling enhances neutrophil sensitivity toward Toll-like receptor (Tlr)2 activation which, in turn, signals their arrival at a site of invasion and may facilitate antimicrobial function. PMID: 19812191

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: mmu:16423

UniGene: Mm.31752

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1