Recombinant Mouse Leukocyte surface antigen CD47(Cd47)

Code CSB-CF713985MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q61735
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTD QNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNR
Source in vitro E.coli expression system
Gene Names Cd47
Protein Names Recommended name: Leukocyte surface antigen CD47 Alternative name(s): Integrin-associated protein Short name= IAP CD_antigen= CD47
Expression Region 19-303
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: mmu:16423

UniGene: Mm.31752

Related Products

Cd47 Proteins

Cd47 Proteins for Mus musculus (Mouse)

Cd47 ELISA Kit

Cd47 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.