Recombinant Human Interleukin-37(IL37),partial (Active)

In Stock
Code CSB-AP004431HU
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q9NZH6
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4
Alias Interleukin-37; FIL1 Zeta; IL-1X; Interleukin-1 Family Member 7; IL-1F7; Interleukin-1 Homolog 4; IL-1H; IL-1H4; Interleukin-1 Zeta; IL-1 Zeta; Interleukin-1-Related Protein; IL-1RP1; Interleukin-23; IL-37; IL37; FIL1Z; IL1F7; IL1H4; IL1RP1
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human IL-18R beta in functional ELISA is less than 10 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Research Area Immunology
Source E.coli
Gene Names IL37
Expression Region 53-218aa
Tag Info Tag-Free
Mol. Weight 18.7 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
Subcellular Location Cytoplasm, cytosol, Nucleus, Secreted
Protein Families IL-1 family
Tissue Specificity In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis,
Database Links

HGNC: 15563

OMIM: 605510

KEGG: hsa:27178

STRING: 9606.ENSP00000263326

UniGene: Hs.166371

Related Products

IL37 Antibodies

IL37 Antibodies for Homo sapiens (Human)

IL37 Antibodies for Human

IL37 Proteins

IL37 Proteins for Homo sapiens (Human)

IL37 ELISA Kit

IL37 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.