Recombinant Human Interleukin-37(IL37)

Code CSB-EP865190HU(A4)
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q9NZH6
Abbreviation IL37
Relevance Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias FIL1 zetaIL-1XInterleukin-1 family member 7
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Research Area Immunology
Source E.coli
Gene Names IL37
Protein Names Recommended name: Interleukin-37Alternative name(s): FIL1 zeta IL-1X Interleukin-1 family member 7 Short name= IL-1F7 Interleukin-1 homolog 4 Short name= IL-1H Short name= IL-1H4 Interleukin-1 zeta Short n
Expression Region 1-218aa
Tag Info N-terminal GST-tagged
Mol. Weight 51.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
Subcellular Location Cytoplasm, cytosol, Nucleus, Secreted
Protein Families IL-1 family
Tissue Specificity In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis,
Database Links

HGNC: 15563

OMIM: 605510

KEGG: hsa:27178

STRING: 9606.ENSP00000263326

UniGene: Hs.166371

Related Products

IL37 Antibodies

IL37 Antibodies for Homo sapiens (Human)

IL37 Antibodies for Human

IL37 Proteins

IL37 Proteins for Homo sapiens (Human)

IL37 ELISA Kit

IL37 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.