Recombinant Human CD58 protein (CD58), partial, Biotinylated (Active)

In Stock
Code CSB-MP6138HUj8-B
Abbreviation Recombinant Human CD58 protein, partial, Biotinylated (Active)
MSDS
Size $166
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD2(CSB-MP004894HU) at 5 μg/ml can bind Human CD58. The EC50 is 337.0-430.1 ng/mL. Biological Activity Assay
  • The purity of CD58 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD2(CSB-MP004894HU) at 5 μg/mL can bind Human CD58. The EC50 is 337.0-430.1 ng/mL.
Target Names
Uniprot No.
Alternative Names
CD58 protein; CD58
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-215aa
Target Protein Sequence
FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Mol. Weight
49.9 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CD58 mediates T cell costimulation through its interaction with CD2, a pathway critical to immune synapse formation and tumor immune evasion mechanisms. This recombinant fragment spanning residues 29–215 demonstrates quantifiable binding to immobilized CD2 with an EC50 of 337.0–430.1 ng/mL in functional ELISA, providing a validated reagent for cell adhesion assays investigating lymphocyte-target cell interactions and for antibody development programs targeting the CD58–CD2 axis. Mammalian expression ensures native glycosylation patterns that preserve the conformational epitopes required for accurate binding kinetics in immune cell trafficking studies and tumor metastasis models. The protein meets the purity and endotoxin criteria typical for functional assays, with >95% purity by SDS-PAGE and <1.0 EU/μg endotoxin, supporting its use in cell-based migration and invasion experiments where low endotoxin levels are essential to avoid confounding inflammatory responses.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*