Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial (Active)

In Stock
Code CSB-MP5116GUR
Abbreviation Recombinant Finegoldia HMPREF0391_11247 protein, partial (Active)
MSDS
Size $126
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Peptostreptococcus magnus protein L at 2 μg/ml can bind Anti-CTLA4 recombinant antibody(CSB-RA006163MA2HU).The EC50 is 1.601-1.944 ng/mL. Biological Activity Assay
  • The purity of Protein L was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Peptostreptococcus magnus protein L at 2 μg/mL can bind Anti-protein L recombinant antibody(CSB-RA006163MA1HU).The EC50 is 1.601-1.944 ng/mL.
Uniprot No.
Species
Finegoldia magna ATCC 53516
Source
Mammalian cell
Expression Region
106-470aa
Target Protein Sequence
KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG
Mol. Weight
43.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant LPXTG-motif cell wall anchor domain protein from Finegoldia magna ATCC 53516 is an active protein expressed in a mammalian system to ensure proper folding and functional integrity. This protein covers amino acids 106 to 470 of the native sequence and includes an N-terminal 10xHis tag for convenient purification and detection. Supplied as a lyophilized powder, it demonstrates exceptional purity, greater than 95% as confirmed by both SDS-PAGE and SEC-HPLC. Functional activity was assessed using ELISA, where the recombinant LPXTG-motif cell wall anchor domain protein binds specifically to anti-protein L recombinant antibody (CSB-RA006163MA1HU), with an EC50 ranging from 1.601 to 1.944 ng/mL. These results validate its utility in studies involving bacterial adhesion mechanisms, antibody interaction assays, and microbiome-related research.

The LPXTG-motif cell wall anchor domain protein is significant for Finegoldia magna, a Gram-positive anaerobic bacterium. This protein domain is recognized as essential for attaching proteins to the bacterial cell wall via the action of sortases, which cleave the LPXTG motif and facilitate this anchoring process. Specifically, strain ATCC 53516 of Finegoldia magna may express such proteins. However, detailed molecular characterizations are limited and merit further investigation.

Finegoldia magna is an increasingly recognized opportunistic pathogen, often isolated from clinical specimens associated with various infections, including soft tissue abscesses, septic arthritis, and necrotizing fasciitis [1][2]. It resides within the normal human microbiota, particularly in the gastrointestinal tract and skin, which raises questions regarding its pathogenic potential versus its role as a commensal organism [3][4]. The bacterium expresses multiple surface proteins, some of which may include LPXTG motif proteins that have roles in adhesion and immune evasion [5][6].

The binding capabilities of these proteins, particularly those that can interact with human serum albumin (HSA) [7][8], imply a sophisticated adaptation to the host environment. The PAB (peptostreptococcal albumin-binding) protein identified in F. magna demonstrates a domain with considerable homology to HSA-binding proteins, illustrating its mechanism for immune evasion by sequestering vital host molecules [9]. Moreover, the ability of this bacterium to induce significant inflammatory responses through its secreted proteins underscores its pathogenic mechanisms [3][10].

Furthermore, the presence of LPXTG-motif proteins in F. magna represents an important area of study for understanding the strategies employed by this organism to colonize human tissues effectively and circumvent host defenses, making it a relevant target for research focusing on bacterial virulence factors [5][11]. Continued exploration into the specific functions of the LPXTG-motif anchor proteins in F. magna will enhance our understanding of its pathogenicity and adaptation within the human host.

References:
[1] A. Neumann, L. Björck, & I. Frick. Finegoldia magna, an anaerobic gram-positive bacterium of the normal human microbiota, induces inflammation by activating neutrophils. Frontiers in Microbiology, vol. 11, 2020. https://doi.org/10.3389/fmicb.2020.00065
[2] M. Zou, Z. Yang, et al. Gut microbiota on admission as predictive biomarker for acute necrotizing pancreatitis. Frontiers in Immunology, vol. 13, 2022. https://doi.org/10.3389/fimmu.2022.988326
[3] E. Murphy and I. Frick. Gram-positive anaerobic cocci – commensals and opportunistic pathogens. Fems Microbiology Reviews, vol. 37, no. 4, p. 520-553, 2013. https://doi.org/10.1111/1574-6976.12005
[4] E. Taş and K. Ülgen. Understanding the adhd-gut axis by metabolic network analysis. Metabolites, vol. 13, no. 5, p. 592, 2023. https://doi.org/10.3390/metabo13050592
[5] D. Breidung, S. Delavari, I. Megas, B. Reichert, & M. Billner. Necrotizing fasciitis after panniculectomy caused by finegoldia magna. Plastic and Reconstructive Surgery Global Open, vol. 12, no. 4, p. e5773, 2024. https://doi.org/10.1097/gox.0000000000005773
[6] J. Byeon, K. Blizinsky, et al. Insights into the skin microbiome of sickle cell disease leg ulcers. Wound Repair and Regeneration, vol. 29, no. 5, p. 801-809, 2021. https://doi.org/10.1111/wrr.12924
[7] E. Murphy, M. Mörgelin, D. Reinhardt, A. Olin, L. Björck, & I. Frick. Identification of molecular mechanisms used by finegoldia magna to penetrate and colonize human skin. Molecular Microbiology, vol. 94, no. 2, p. 403-417, 2014. https://doi.org/10.1111/mmi.12773
[8] E. Bormotova and T. Gupalova. The relationship between albumin-binding capacity of recombinant polypeptide and changes in the structure of albumin-binding domain. Bulletin of Experimental Biology and Medicine, vol. 159, no. 3, p. 393-397, 2015. https://doi.org/10.1007/s10517-015-2972-z
[9] P. Samuel, M. Rickard, M. Boob, M. Gruebele, & T. Pogorelov. In silico protein dynamics in the human cytoplasm: partial folding, misfolding, fold switching, and non‐native interactions. Protein Science, vol. 32, no. 11, 2023. https://doi.org/10.1002/pro.4790
[10] S. Lejon, J. Cramer, & P. Nordberg. Structural basis for the binding of naproxen to human serum albumin in the presence of fatty acids and the ga module. Acta Crystallographica Section F Structural Biology and Crystallization Communications, vol. 64, no. 2, p. 64-69, 2008. https://doi.org/10.1107/s174430910706770x
[11] M. Hoeksema, M. Eijk, H. Haagsman, & K. Hartshorn. Histones as mediators of host defense, inflammation and thrombosis. Future Microbiology, vol. 11, no. 3, p. 441-453, 2016. https://doi.org/10.2217/fmb.15.151

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*