Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial (Active)

In Stock
Code CSB-EP5116GURc7
Abbreviation Recombinant Finegoldia HMPREF0391_11247 protein, partial (Active)
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Peptostreptococcus magnus protein L at 2 μg/ml can bind anti-CTLA4 recombinant antibody(CSB-RA006163MA2HU). The EC50 is 1.764-2.413 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Peptostreptococcus magnus protein L at 2 μg/ml can bind anti-CTLA4 recombinant antibody(CSB-RA006163MA2HU). The EC50 is 1.764-2.413 ng/mL.
Target Names
Protein L
Uniprot No.
Species
Finegoldia magna ATCC 53516
Source
E.coli
Expression Region
106-470aa
Target Protein Sequence
KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG
Mol. Weight
47.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein is co-expressed with the C-terminal 6xHis-tag in E. coli. Its expression region encompasses the amino acid sequence from 106 to 470 of Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein. This protein exhibits a purity level exceeding 85% as confirmed by SDS-PAGE analysis. It is provided in a lyophilized powder form, which facilitates storage and handling. Functional assays have demonstrated that this LPXTG-motif cell wall anchor domain protein can effectively bind to anti-protein L antibody (CSB-RA006163MA1HU), with the EC50 ranging from 42.28 to 65.76 ng/mL, indicating its strong affinity for the antibody.

The LPXTG-motif cell wall anchor domain present in Finegoldia magna ATCC 53516 plays crucial roles in the stability and functionality of surface proteins important for the bacterium's adherence and interaction within its ecological niche. As a Gram-positive anaerobic coccus, F. magna utilizes this motif to anchor proteins covalently to the peptidoglycan layer of its cell wall, a process catalyzed by sortase enzymes. The LPXTG motif, recognized by sortase, facilitates the attachment of surface proteins critical for bacterial adherence and pathogenicity [1].

This anchoring mechanism is particularly significant for proteins involved in host interactions. Surface proteins carrying the LPXTG motif can modulate the host immune response, and some studies indicate that these proteins can act as virulence factors. For example, F. magna expresses superantigen Protein L, which can induce inflammation by activating human neutrophils and promoting an inflammatory response [2][3]. Moreover, the LPXTG domain also contributes to the diverse functionality of surface proteins that can interact with host cells, facilitating adhesion and colonization within the gastrointestinal tract [1][3].

Additionally, the surface localization of LPXTG-anchored proteins has been linked to bacterial growth regulation, suggesting that such motifs are instrumental not only for anchorage but also for the dynamic regulation of protein localization during the bacterial cell cycle [4]. The variation in the localization patterns of these proteins during cell division further points to their significant role in maintaining cellular integrity and contributing to the overall pathogenicity of Gram-positive bacteria like F. magna [4].

In summary, the LPXTG-motif cell wall anchor domain in Finegoldia magna is integral in linking various surface proteins to the cell wall, which supports bacterial adherence, modulates host immune responses, and is essential for maintaining cellular functions relevant to growth and virulence.

References:
[1] T. Goto, A. Yamashita, et al. Complete genome sequence of finegoldia magna, an anaerobic opportunistic pathogen. Dna Research, vol. 15, no. 1, p. 39-47, 2008. https://doi.org/10.1093/dnares/dsm030
[2] A. Neumann, L. Björck, & I. Frick. Finegoldia magna, an anaerobic gram-positive bacterium of the normal human microbiota, induces inflammation by activating neutrophils. Frontiers in Microbiology, vol. 11, 2020. https://doi.org/10.3389/fmicb.2020.00065
[3] M. Zou, Z. Yang, et al. Gut microbiota on admission as predictive biomarker for acute necrotizing pancreatitis. Frontiers in Immunology, vol. 13, 2022. https://doi.org/10.3389/fimmu.2022.988326
[4] G. Mathiesen, L. Øverland, K. Kuczkowska, & V. Eijsink. Anchoring of heterologous proteins in multiple lactobacillus species using anchors derived from lactobacillus plantarum. Scientific Reports, vol. 10, no. 1, 2020. https://doi.org/10.1038/s41598-020-66531-7

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*