Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial (Active)

In Stock
Code CSB-EP5116GURc7
Abbreviation Recombinant Finegoldia HMPREF0391_11247 protein, partial (Active)
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Peptostreptococcus magnus protein L at 2 μg/ml can bind anti-CTLA4 recombinant antibody(CSB-RA006163MA2HU). The EC50 is 1.764-2.413 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Peptostreptococcus magnus protein L at 2 μg/ml can bind anti-CTLA4 recombinant antibody(CSB-RA006163MA2HU). The EC50 is 1.764-2.413 ng/mL.
Target Names
Protein L
Uniprot No.
Species
Finegoldia magna ATCC 53516
Source
E.coli
Expression Region
106-470aa
Target Protein Sequence
KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG
Mol. Weight
47.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Protein L, an LPXTG-motif cell wall anchor domain protein from Finegoldia magna ATCC 53516, specifically recognizes and binds to the kappa light chain variable region of immunoglobulins across multiple species and isotypes without interacting with the Fc fragment, making it a critical tool in antibody research, purification and diagnostic development. This E. coli-expressed partial protein spanning residues 106–470 carries a C-terminal 6×His tag for facile purification and has an apparent molecular weight of approximately 47.4 kDa. Functional ELISA validation confirms that immobilized Protein L at a concentration of 2 μg/mL exhibits specific binding to an anti-CTLA4 recombinant antibody (CSB-RA006163MA2HU) with an EC50 value ranging from 1.764 to 2.413 ng/mL, demonstrating that the protein retains the native conformational structure essential for high-affinity antibody interaction. With a purity exceeding 85% as determined by SDS-PAGE and provided as a stable lyophilized powder, this active recombinant Protein L is well-suited for various applications including antibody affinity purification, immunoprecipitation, Western blotting, therapeutic antibody screening, and kinetic binding characterization via surface plasmon resonance or biolayer interferometry.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*