Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial,Biotinylated (Active)

In Stock
Code CSB-EP5116GUR-B
Abbreviation Recombinant Finegoldia HMPREF0391_11247 protein, partial, Biotinylated (Active)
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized anti-CTLA4 antibody (CSB-RA006163MA2HU) at 2 μg/ml can bind Biotinylated Protein L. The EC50 is 1.123-1.761 ng/mL. Biological Activity Assay
  • The purity of Protein L was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized anti-protein L antibody (CSB-RA006163MA1HU) at 2 μg/mL can bind Biotinylated Protein L. The EC50 is 1.123-1.761 ng/mL.
Uniprot No.
Species
Finegoldia magna ATCC 53516
Source
E.coli
Expression Region
106-470aa
Target Protein Sequence
KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG
Mol. Weight
44.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The LPXTG-motif cell wall anchor domain from Finegoldia magna ATCC 53516 exhibits robust immunoglobulin-binding capacity, a property that positions this protein as a valuable tool for antibody capture and detection workflows. Functional ELISA validation demonstrates specific binding to immobilized anti-CTLA4 antibody with an EC50 of 1.123–1.761 ng/mL, confirming its utility as a detection reagent in binding assays and as a positive control in immunoassay development. Expressed in E. coli as a biotinylated construct spanning residues 106–470 with N-terminal 10xHis-Avi tags, this protein achieves greater than 95% purity by SDS-PAGE and maintains endotoxin levels below 1.0 EU/μg, meeting the quality thresholds commonly required for antibody characterization studies and assay optimization experiments. The site-specific biotinylation enables straightforward immobilization on streptavidin surfaces, supporting applications in surface plasmon resonance, ELISA-based antibody screening, and multiplex immunoassay controls where reproducible orientation and presentation are critical.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*