Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175(HP-0175) (Active)

Code CSB-EP345551HUV
Product Type Other
Size US$2062Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P56112
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 μg/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.
Storage Buffer Tris-based buffer,50% glycerol
Alias Rotamase HP_0175
Species Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Biological_Activity Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 μg/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Sequence KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK
Research Area Others
Source E.coli
Gene Names HP-0175
Expression Region 22-299aa
Tag Info N-terminal GST-tagged
Mol. Weight 58.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

HP-0175 Proteins

HP-0175 Proteins for Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.