Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-AP005901HU |
Size | US$5163 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | > 98 % by SDS-PAGE and HPLC analyses. |
Endotoxin | Less than 0.01 EU/μg of rHuFlt3-Ligand GMP as determined by LAL method. |
Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human AML5 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 106 IU/mg. |
Target Names | FLT3LG |
Uniprot No. | P49771 |
Research Area | Immunology |
Alternative Names |
FL; Flt 3 ligand; Flt 3L; Flt3 L; FLT3 LG; Flt3 ligand; Flt3L; FLT3L_HUMAN; Flt3lg; Fms related tyrosine kinase 3 ligand; Fms-related tyrosine kinase 3 ligand; SL cytokine
|
Species | Homo sapiens (Human) |
Source | E.Coli |
Expression Region | 27-181aa |
Complete Sequence | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA |
Mol. Weight | 17.6 kDa |
Protein Length | Partial |
Tag Info |
Tag-Free |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
|
Gene References into Functions |
|
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted. |
Database Links |
HGNC: 3766 OMIM: 600007 KEGG: hsa:2323 STRING: 9606.ENSP00000468977 UniGene: Hs.428 |