Name: Recombinant Human Fms-related Tyrosine Kinase 3 Ligand(FLT3LG),partial (Active) (GMP)
Brand: CUSABIO
SKU: CSB-AP005901HU

Product Details

Purity	> 98 % by SDS-PAGE and HPLC analyses.
Endotoxin	Less than 0.01 EU/μg of rHuFlt3-Ligand GMP as determined by LAL method.
Activity	Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human AML5 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 106 IU/mg.
Target Names	FLT3LG
Uniprot No.	P49771
Research Area	Immunology
Alternative Names	FL; Flt 3 ligand; Flt 3L; Flt3 L; FLT3 LG; Flt3 ligand; Flt3L; FLT3L_HUMAN; Flt3lg; Fms related tyrosine kinase 3 ligand; Fms-related tyrosine kinase 3 ligand; SL cytokine
Species	Homo sapiens (Human)
Source	E.Coli
Expression Region	27-181aa
Complete Sequence	TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
Mol. Weight	17.6 kDa
Protein Length	Partial
Tag Info	Tag-Free
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Gene References into Functions	our study demonstrates that Flt3L acts as an important regulator of ILCs lymphopoiesis and it can be used as a tool to expand and study ILCs precursors in the BM. PMID: 29317685 Results elucidated a novel resistance mechanism that FL attenuated inhibitory effects of FLT3 inhibitors mainly through the activation of Wt-FLT3, not mutated FLT3 in acute myeloid leukemia. PMID: 27331411 it is likely that TGFbeta1 and FL, both abundantly produced by bone marrow stromal cells, function in a coordinated manner to render mixed-lineage leukemia gene-rearranged acute lymphoblastic leukemia cells chemoresistant PMID: 28917156 serum levels can be a marker of cutaneous manifestation in dermatomyositis and marker of microangiopathy in systemic sclerosis PMID: 26559027 Pre-treatment serum levels of FLT3-L were higher than controls. FLT3-L correlated positively with all soluble angiogenic factors, as well with bone marrow microvascular density. Post-treatment FLT3-L decreased significantly in responders to therapy. PMID: 26521986 The immunohistochemical expression of caveolin-1 and podocalyxin in lungs from rats challenged with a 2-kDa macrophage-activating lipopeptide (MALP-2) and Flt3L, was examined. PMID: 24419512 Flt3L enhances global T cell and humoral immunity as well as both the numbers and antigen capture capacity of migratory dendritic cells and classical lymphoid-resident dendritic cells PMID: 25135299 Human bone marrow stromal cells simultaneously support B and T/NK lineage development from human haematopoietic progenitors: a principal role for flt3 ligand in lymphopoiesis. PMID: 22463758 A novel dendritic cell(DC) progenitor regulatory pathway in which PGE(2) signaling through EP1/EP3 receptors regulates Flt3 expression and downstream STAT3 activation and survivin expression, required for optimal progenitor survival and differentiation. PMID: 22110249 data demonstrate that the Flt3L/TK gene therapeutic approach can induce systemic immunological memory capable of recognizing a brain tumor neoantigen in a model of recurrent GBM PMID: 21505426 FLT3 ligand(FL) leads to further activation of FLT3 mutants and is especially important in light of recent findings of elevated FL levels in acute myeloid leukemia patients in response to chemotherapy. PMID: 21516120 FLT3 ligand impedes the efficacy of FLT3 inhibitors in vitro and in vivo. PMID: 21263155 results demonstrate that hsFlt3L induces the proliferation of canine DCs and support its use in upcoming clinical trials for canine glioblastoma multiforme PMID: 20552015 Exogenous administration of Flt3 ligand increases the CD11c-expressing dendritic cell population, which, when expressing IL-15, significantly expands mature natural killer (NK) cells via enhanced survival and proliferation. PMID: 20142363 Data suggest that Flt3 Ligand(FL) gene regulated by Egr-1 promoter can protect hematopoiesis from 5-Fu injury. PMID: 19426596 Treatment with recombinant human FLT3 ligand prevents ovalbumin-induced asthma in the mouse by stimulating IL-12 secretion by dendritic cells. It may provide a useful adjuvant in the treatment of human asthma. PMID: 11710537 effect of recombinant human Flt-3 ligand on dendritic cell populations in mouse spleen PMID: 11877288 Expression of FLT3L in primary gastrointestinal non-Hodgkin's lymphoma. PMID: 11956621 Antiapoptotic cytokine IL-3 + SCF + FLT3L influence on proliferation of gamma-irradiated AC133+/CD34+ progenitor cells. PMID: 12002675 Incubation of acute stem cell leukemia cells with the flt3 ligand induced the expression of unilineage HGF receptors, allowing cell growth without differentiation . PMID: 12036900 Flt3L-mobilized DC from cancer patients require a sequence of specific signals for maturation, including initial treatment with granulocyte macrophage-colony stimulating factor followed by a combination of maturation signals such as CD40L and IFN-gamma. PMID: 12223523 Administration of Flt3-L enhances a Th1-type response against mouse thyroglobulin by selective expansion of mouse dendritic cell subsets that results in induction of a severe type of murine autoimmune thyroiditis. PMID: 12759428 A single dose of recombinant human Flt3L locally applied in the trachea of rats results in a dose-dependent increase of dendritic cells as well as CD4+ and CD8+ T lymphocytes with different responses in lung interstitium and bronchoalveolar space. PMID: 12817014 Thrombopoietin cooperates with FLT3-L, inducing CD34+ HPCs to undergo a 400-fold expansion in cell numbers. PMID: 14670916 endogenous FLT3LG has distinct effects on the kinetics of reconstitution of DCs and NK ce; speed of recovery of CD11c(+)CD123(low) DC1 exceeded that of CD11c(-) CD123(+) DC2, and correlated with plasma levels of flt3 ligand PMID: 14764540 flt3L is a potent immunorestorative agent that enhances both thymic-dependent and thymic-independent pathways of T-cell regeneration PMID: 15226184 Increased serum levels of the early hemopoietic cytokine FLT3-L could explain increased numbers of circulating dendritic cells in Langerhans cell histiocytosis. PMID: 15728521 Human flt3 ligand-mediated generation and mobilization of naive dendritic cells, fully responsive to infectious stimuli, accelerates recovery from endotoxin tolerance-related immunoparalysis in a murine infection model. PMID: 15905588 Purified recombinant FLT3 ligand had dose-dependent expansion activity on bone marrow nucleated cells. PMID: 15914030 Addition of Flt3-L to the optimal combination of megakaryocyte (Mk) growth factor MGDF, stem cell factor, interleukin-3, and granulocyte-macrophage colony stimulating factor GM-CSF reduces both fold expansion of Mk progenitors and Mk colony numbers. PMID: 16487027 Flt-3L treatment expands conventional & plasmacytoid dendritic cells in vivo, increasing antigen presentation by direct- & cross-presentation. It augments the size of an immune response but requires further adjuvant activation to alter its quality. PMID: 17949888 Results indicate that Flt3-L is strongly expressed at the site of inflammation in human rheumatoid arthritis, and it exerts both pro-inflammatory and tissue destructive properties once in the joint cavity. PMID: 18982072 Show More Hide All
Subcellular Location	[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Database Links	HGNC: 3766 OMIM: 600007 KEGG: hsa:2323 STRING: 9606.ENSP00000468977 UniGene: Hs.428

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-AP005901HU
Size	US$5163
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Fms-related Tyrosine Kinase 3 Ligand(FLT3LG),partial (Active) (GMP)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage