Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.

Target Names

LGALS8

Uniprot No.

O00214

Research Area

Cancer

Alternative Names

Gal 8; Gal-8; Gal8; Galectin 8; Galectin-8; galectin-8g; Lectin galactoside binding soluble 8; LEG8_HUMAN; LGAL S8 ; Lgals8; PCTA 1; PCTA-1; PCTA1; Po66 carbohydrate binding protein; Po66 carbohydrate-binding protein; Po66 CBP ; Po66-CBP; Prostate carcinoma tumor antigen 1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-317aa

Target Protein Sequence

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

Mol. Weight

62.8kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Galectin-8 plays a multifaceted role in tumor progression by modulating cell adhesion, apoptosis, and immune evasion, making it a valuable target in cancer biology research. This recombinant human LGALS8 (full-length, aa 1–317) carries an N-terminal GST tag and has been functionally validated by ELISA, demonstrating specific binding to immobilized SLC31A1 with an EC50 of 373.90–524.30 μg/ml — evidence that supports use in protein–protein interaction studies, ligand-binding assays, and as a positive control in galectin-focused screening panels. Produced in *E. coli*, the protein provides a non-glycosylated format that isolates lectin-intrinsic binding activity from mammalian glycosylation artifacts, which is particularly informative when dissecting carbohydrate-independent interactions. Purity exceeding 90% by SDS-PAGE satisfies the quality thresholds commonly required for functional ELISAs and in vitro binding characterization, though researchers planning cell-based assays should note that endotoxin levels have not been tested and may require additional assessment.

Target Background

Function

Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.

Gene References into Functions

analysis of crystallographic structures of the galectin-8 N-terminal domain (galectin-8N) in complex with LNT and LNnT PMID: 28000747
Gal-8 served as a new positive prognostic factor for the OS and DFS of ovarian cancer patients. PMID: 29361803
the natural and conserved expression of Gal-8 in tumour cells is responsible for the metastatic evolution of prostate cancer. PMID: 28591719
Both Gal-8 isoforms led to enhanced adhesion of myeloma cells to vascular endothelium under dynamic shear stress conditions, Gal-8L (by more than 40-fold) even stronger than Gal-8S. PMID: 27287437
Our data indicate that Gal-8 interacts with ALCAM at the surface of breast cancer cells through glycosylation-dependent mechanisms. A novel heterophilic interaction between ALCAM and Gal-8 is demonstrated here, suggesting its physiologic relevance in the biology of breast cancer cells PMID: 27130882
we detected Gal-8 in human cerebrospinal fluid, suggesting a role in the CNS immune-surveillance circuit. In addition, we show that MS patients generate function-blocking anti-Gal-8 antibodies with pathogenic potential. Furthermore, circulating anti-Gal-8 antibodies associate with relapsing-remitting MS, and not with progressive MS phenotypes, predicting clinical disability at diagnosis within the first year of follow-up PMID: 28650992
Data suggest that galectin-8 is a potential independent favorable prognostic biomarker for survival and recurrence of patients with gastric cancer after surgery. PMID: 27444274
this study uncovers a unique molecular mechanism of lymphangiogenesis in which galectin-8-dependent crosstalk among VEGF-C, podoplanin and integrin pathways plays a key role. PMID: 27066737
Platelet-derived factor V/Va is generated following endocytosis of the plasma-derived molecule by the platelet precursor cells, megakaryocytes, via a two receptor system consisting of LRP-1 and an unidentified specific "binding site". PMID: 25800007
Gal-8 expression is a potential independent unfavorable prognostic indicator for postoperative recurrence of patients with localized pT1 clear cell renal cell carcinoma PMID: 25499921
The fundamental roles of galectin-8 in human anaplastic large cell lymphoma PMID: 25573487
The implications of gal-8 in tumor angiogenesis remain to be further explored, but it is exciting to speculate that modulating gal-8-glycan interactions could be used to block lymphatic-vascular connections vital for metastasis PMID: 24939370
We integrate here the available information on Gal-8 expression in different tumor types and attempt to elucidate associations of its expression and localization with tumor progression[review] PMID: 24696431
these results not only confirm the pro-inflammatory role we have already proposed for Gal-8 in other cellular systems but also suggest that this lectin is orchestrating the interaction between leukocytes, platelets and endothelial cells PMID: 24957054
Focusing on the F19Y change in galectin-8, we study of consequences of a single-site substitution in the carbohydrate recognition domain of this family of cellular effectors. PMID: 24418318
analysis of how human Galectin-8C domain interacts with its glycan ligands PMID: 23555773
Data indicate that the binding site in galectin-8 is essential for the recruitment of the autophagy receptor NDP52 to cytosol-exposed Salmonella Typhimurium. PMID: 23386746
Association of galectin-8 (F19Y) occurrence with autoimmune diseases in a Caucasian population. PMID: 22683700
Galectin-8 promotes cytoskeletal rearrangement in trabecular meshwork cells through activation of Rho signaling. PMID: 22973445
Results indicate a difference in specificity between N-terminal and C-terminal carbohydrate recognition domains (N-CRD and C-CRD) of galectin-8. PMID: 22913484
This is the first study that relates a galectin, an endogenous lectin family, to IgA nephritis and thus should stimulate new avenues of research into the pathophysiology of the disease. PMID: 22173878
a novel role for the tandem repeat Gal8 in promoting FV endocytosis. PMID: 22267735
results illustrate how cells deploy the danger receptor galectin 8 to combat infection by monitoring endosomal and lysosomal integrity on the basis of the specific lack of complex carbohydrates in the cytosol PMID: 22246324
Gal-8 was expressed by villous and extravillous cytotrophoblast. PMID: 21862124
galectin-8 loss might be an early step in the development of malignant lesions of the bladder and is a significant independent predictor of recurrence PMID: 21757871
Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans. PMID: 21288902
Studies indicated that Gal-8 was expressed both in the cytoplasm and nucleus in ECs of normal and tumor vessels. PMID: 20876211
Platelets not only contain Gal-8, but also expose Gal-8 after thrombin activation. Findings reveal Gal-8 isoforms as a potent platelet activator; immobilized Gal-8 promotes platelet adhesion/spreading. PMID: 20858220
Galectin-8 up-regulation is associated with hypopharyngeal and laryngeal tumor progression. PMID: 20044599
The binding ability of galectin-8 to membrane-associated GM3 was confirmed using CHO cells, which predominantly express GM3 PMID: 12851289
Human galectin-8 induced firm and reversible adhesion of peripheral blood neutrophils but not eosinophils to a plastic surface in a lactose-sensitive manner; galectin-8 is a novel factor that modulates the neutrophil function. PMID: 12881409
REVIEW: isoforms and role in neoplastic transformation/cancer PMID: 14758080
galectin-8 is a modulator of cellular growth through up-regulation of p21 PMID: 15753078
Gal-8 constitutes a novel extracellular stimulus for T cells, able to bind specific beta1 integrins and to trigger signaling pathways conducive to cell spreading. PMID: 16368432
The affinity of Gal-8 and its carbohydrate recognition domains for ligands in solution and at the cell surface is explored. PMID: 17339281
galectin-8 sorting is based on carbohydrate fine specificity PMID: 17580315
The function of galectin-8 in Jurkat T-cells, is analysed. PMID: 18024965
allows Gal-8 to signal phosphatidylserine exposure in leukocytes entirely through C-terminal domain recognition of polyLacNAc glycans PMID: 18456665
Gal8 modulates trabecular meshwork cell adhesion and spreading, at least in part, by interacting with alpha2-3-sialylated glycans on beta(1) integrins. PMID: 18849583
Galectin-8 was expressed in the majority of papillary carcinomas. Positive but weaker staining was found in some of follicular thyroid carcinomas and adenomas. Galectin-8 found in hyperplastic areas adjacent to tumor was weakly positive in 9 of 31 cases. PMID: 19009371
These data suggest a role for galectin-8 and podoplanin in supporting the connection of the lymphatic endothelium to the surrounding extracellular matrix, most likely in cooperation with other glycoproteins on the surface of lymphatic endothelial cells. PMID: 19268462
The glycan-binding proteins of the galectin family can modulate the immune system. Anti-galectin autoantibodies thus could have functional and/or pathogenic implications in inflammatory processes and autoimmunity. PMID: 19395456
crystal of a protease-resistant mutant form of human galectin-8 was obtained using the hanging-drop method and was found to belong to the tetragonal space group P4(3)2(1)2 PMID: 19407390

Hide All

Subcellular Location

Cytoplasmic vesicle. Cytoplasm, cytosol.

Tissue Specificity

Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.

Database Links

HGNC: 6569

OMIM: 606099

KEGG: hsa:3964

UniGene: Hs.4082

Code	CSB-EP012894HU
Abbreviation	Recombinant Human LGALS8 protein (Active)
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC₅₀ of human LGALS8 is 373.90-524.30 μg/ml.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Galectin-8 (LGALS8) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage