Recombinant Human Galectin-8(LGALS8) (Active)

Code CSB-EP012894HU
Product Type Other
Size US$1726Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. O00214
Relevance Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.
Storage Buffer Tris-based buffer,50% glycerol
Alias Po66 carbohydrate-binding protein
Species Homo sapiens (Human)
Biological_Activity Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Research Area Cancer
Source E.coli
Gene Names LGALS8
Expression Region 1-317aa
Tag Info N-terminal GST-tagged
Mol. Weight 62.8kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy
Subcellular Location Cytoplasmic vesicle, Cytoplasm, cytosol
Tissue Specificity Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.
Database Links

HGNC: 6569

OMIM: 606099

KEGG: hsa:3964

UniGene: Hs.4082

Related Products

LGALS8 Antibodies

LGALS8 Antibodies for Homo sapiens (Human)

LGALS8 Antibodies for Human

LGALS8 Proteins

LGALS8 Proteins for Homo sapiens (Human)

LGALS8 ELISA Kit

LGALS8 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.