Recombinant Human Galectin-8 (LGALS8) (Active)

In Stock
Code CSB-EP012894HU
Abbreviation Recombinant Human LGALS8 protein (Active)
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Gal 8; Gal-8; Gal8; Galectin 8; Galectin-8; galectin-8g; Lectin galactoside binding soluble 8; LEG8_HUMAN; LGAL S8 ; Lgals8; PCTA 1; PCTA-1; PCTA1; Po66 carbohydrate binding protein; Po66 carbohydrate-binding protein; Po66 CBP ; Po66-CBP; Prostate carcinoma tumor antigen 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-317aa
Target Protein Sequence
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Mol. Weight
62.8kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Galectin-8 plays a multifaceted role in tumor progression by modulating cell adhesion, apoptosis, and immune evasion, making it a valuable target in cancer biology research. This recombinant human LGALS8 (full-length, aa 1–317) carries an N-terminal GST tag and has been functionally validated by ELISA, demonstrating specific binding to immobilized SLC31A1 with an EC50 of 373.90–524.30 μg/ml — evidence that supports use in protein–protein interaction studies, ligand-binding assays, and as a positive control in galectin-focused screening panels. Produced in *E. coli*, the protein provides a non-glycosylated format that isolates lectin-intrinsic binding activity from mammalian glycosylation artifacts, which is particularly informative when dissecting carbohydrate-independent interactions. Purity exceeding 90% by SDS-PAGE satisfies the quality thresholds commonly required for functional ELISAs and in vitro binding characterization, though researchers planning cell-based assays should note that endotoxin levels have not been tested and may require additional assessment.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.
Gene References into Functions
  1. analysis of crystallographic structures of the galectin-8 N-terminal domain (galectin-8N) in complex with LNT and LNnT PMID: 28000747
  2. Gal-8 served as a new positive prognostic factor for the OS and DFS of ovarian cancer patients. PMID: 29361803
  3. the natural and conserved expression of Gal-8 in tumour cells is responsible for the metastatic evolution of prostate cancer. PMID: 28591719
  4. Both Gal-8 isoforms led to enhanced adhesion of myeloma cells to vascular endothelium under dynamic shear stress conditions, Gal-8L (by more than 40-fold) even stronger than Gal-8S. PMID: 27287437
  5. Our data indicate that Gal-8 interacts with ALCAM at the surface of breast cancer cells through glycosylation-dependent mechanisms. A novel heterophilic interaction between ALCAM and Gal-8 is demonstrated here, suggesting its physiologic relevance in the biology of breast cancer cells PMID: 27130882
  6. we detected Gal-8 in human cerebrospinal fluid, suggesting a role in the CNS immune-surveillance circuit. In addition, we show that MS patients generate function-blocking anti-Gal-8 antibodies with pathogenic potential. Furthermore, circulating anti-Gal-8 antibodies associate with relapsing-remitting MS, and not with progressive MS phenotypes, predicting clinical disability at diagnosis within the first year of follow-up PMID: 28650992
  7. Data suggest that galectin-8 is a potential independent favorable prognostic biomarker for survival and recurrence of patients with gastric cancer after surgery. PMID: 27444274
  8. this study uncovers a unique molecular mechanism of lymphangiogenesis in which galectin-8-dependent crosstalk among VEGF-C, podoplanin and integrin pathways plays a key role. PMID: 27066737
  9. Platelet-derived factor V/Va is generated following endocytosis of the plasma-derived molecule by the platelet precursor cells, megakaryocytes, via a two receptor system consisting of LRP-1 and an unidentified specific "binding site". PMID: 25800007
  10. Gal-8 expression is a potential independent unfavorable prognostic indicator for postoperative recurrence of patients with localized pT1 clear cell renal cell carcinoma PMID: 25499921
  11. The fundamental roles of galectin-8 in human anaplastic large cell lymphoma PMID: 25573487
  12. The implications of gal-8 in tumor angiogenesis remain to be further explored, but it is exciting to speculate that modulating gal-8-glycan interactions could be used to block lymphatic-vascular connections vital for metastasis PMID: 24939370
  13. We integrate here the available information on Gal-8 expression in different tumor types and attempt to elucidate associations of its expression and localization with tumor progression[review] PMID: 24696431
  14. these results not only confirm the pro-inflammatory role we have already proposed for Gal-8 in other cellular systems but also suggest that this lectin is orchestrating the interaction between leukocytes, platelets and endothelial cells PMID: 24957054
  15. Focusing on the F19Y change in galectin-8, we study of consequences of a single-site substitution in the carbohydrate recognition domain of this family of cellular effectors. PMID: 24418318
  16. analysis of how human Galectin-8C domain interacts with its glycan ligands PMID: 23555773
  17. Data indicate that the binding site in galectin-8 is essential for the recruitment of the autophagy receptor NDP52 to cytosol-exposed Salmonella Typhimurium. PMID: 23386746
  18. Association of galectin-8 (F19Y) occurrence with autoimmune diseases in a Caucasian population. PMID: 22683700
  19. Galectin-8 promotes cytoskeletal rearrangement in trabecular meshwork cells through activation of Rho signaling. PMID: 22973445
  20. Results indicate a difference in specificity between N-terminal and C-terminal carbohydrate recognition domains (N-CRD and C-CRD) of galectin-8. PMID: 22913484
  21. This is the first study that relates a galectin, an endogenous lectin family, to IgA nephritis and thus should stimulate new avenues of research into the pathophysiology of the disease. PMID: 22173878
  22. a novel role for the tandem repeat Gal8 in promoting FV endocytosis. PMID: 22267735
  23. results illustrate how cells deploy the danger receptor galectin 8 to combat infection by monitoring endosomal and lysosomal integrity on the basis of the specific lack of complex carbohydrates in the cytosol PMID: 22246324
  24. Gal-8 was expressed by villous and extravillous cytotrophoblast. PMID: 21862124
  25. galectin-8 loss might be an early step in the development of malignant lesions of the bladder and is a significant independent predictor of recurrence PMID: 21757871
  26. Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans. PMID: 21288902
  27. Studies indicated that Gal-8 was expressed both in the cytoplasm and nucleus in ECs of normal and tumor vessels. PMID: 20876211
  28. Platelets not only contain Gal-8, but also expose Gal-8 after thrombin activation. Findings reveal Gal-8 isoforms as a potent platelet activator; immobilized Gal-8 promotes platelet adhesion/spreading. PMID: 20858220
  29. Galectin-8 up-regulation is associated with hypopharyngeal and laryngeal tumor progression. PMID: 20044599
  30. The binding ability of galectin-8 to membrane-associated GM3 was confirmed using CHO cells, which predominantly express GM3 PMID: 12851289
  31. Human galectin-8 induced firm and reversible adhesion of peripheral blood neutrophils but not eosinophils to a plastic surface in a lactose-sensitive manner; galectin-8 is a novel factor that modulates the neutrophil function. PMID: 12881409
  32. REVIEW: isoforms and role in neoplastic transformation/cancer PMID: 14758080
  33. galectin-8 is a modulator of cellular growth through up-regulation of p21 PMID: 15753078
  34. Gal-8 constitutes a novel extracellular stimulus for T cells, able to bind specific beta1 integrins and to trigger signaling pathways conducive to cell spreading. PMID: 16368432
  35. The affinity of Gal-8 and its carbohydrate recognition domains for ligands in solution and at the cell surface is explored. PMID: 17339281
  36. galectin-8 sorting is based on carbohydrate fine specificity PMID: 17580315
  37. The function of galectin-8 in Jurkat T-cells, is analysed. PMID: 18024965
  38. allows Gal-8 to signal phosphatidylserine exposure in leukocytes entirely through C-terminal domain recognition of polyLacNAc glycans PMID: 18456665
  39. Gal8 modulates trabecular meshwork cell adhesion and spreading, at least in part, by interacting with alpha2-3-sialylated glycans on beta(1) integrins. PMID: 18849583
  40. Galectin-8 was expressed in the majority of papillary carcinomas. Positive but weaker staining was found in some of follicular thyroid carcinomas and adenomas. Galectin-8 found in hyperplastic areas adjacent to tumor was weakly positive in 9 of 31 cases. PMID: 19009371
  41. These data suggest a role for galectin-8 and podoplanin in supporting the connection of the lymphatic endothelium to the surrounding extracellular matrix, most likely in cooperation with other glycoproteins on the surface of lymphatic endothelial cells. PMID: 19268462
  42. The glycan-binding proteins of the galectin family can modulate the immune system. Anti-galectin autoantibodies thus could have functional and/or pathogenic implications in inflammatory processes and autoimmunity. PMID: 19395456
  43. crystal of a protease-resistant mutant form of human galectin-8 was obtained using the hanging-drop method and was found to belong to the tetragonal space group P4(3)2(1)2 PMID: 19407390

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle. Cytoplasm, cytosol.
Tissue Specificity
Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.
Database Links

HGNC: 6569

OMIM: 606099

KEGG: hsa:3964

UniGene: Hs.4082

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*