Home
Active Protein
Other
Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)

Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)

^{In Stock}

Code	CSB-MP862025HUd9
Abbreviation	Recombinant Human IGFLR1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/ml can bind Human IGFL1 (CSB-MP764932HUh8), the EC₅₀ is 4.640-5.722 ng/mL.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1 (CSB-MP764932HUh8), the EC₅₀ is 4.640-5.722 ng/mL.

Target Names

IGFLR1

Uniprot No.

Q9H665

Alternative Names

(Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

23-163aa

Target Protein Sequence

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Mol. Weight

44.1 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

IGFLR1 remains a relatively undercharacterized receptor in the IGF-like signaling network, making access to a functionally validated extracellular domain construct particularly valuable for mechanistic studies. This recombinant human IGFLR1 encompasses the extracellular region (aa 23–163) with a C-terminal hFc1 tag, expressed in mammalian cells to preserve native glycosylation and disulfide-mediated folding critical for ligand recognition. Functional ELISA confirms that immobilized IGFLR1 at 2 μg/mL binds human IGFL1 with an EC₅₀ of 4.640–5.722 ng/mL, providing a reliable basis for receptor-ligand interaction assays, SPR/BLI affinity characterization, competitive inhibition studies, and blocking antibody screening. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and therapeutic antibody epitope mapping workflows.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.

Gene References into Functions

Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1. PMID: 21454693

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Database Links

HGNC: 23620

OMIM: 614143

KEGG: hsa:79713

STRING: 9606.ENSP00000246532

UniGene: Hs.352548

Promotions