Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-MP862025HU |
Size | $468 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This Human IGFLR1 (TMEM149, U2AF1L4) recombinant protein was produced in Mammalian cell, where the gene sequence encoding Human IGFLR1 (23-163aa) was expressed with the C-terminal 6xHis tag. The purity of this IGFLR1 protein was greater than 95% by SDS-PAGE. The activity was measured by its binding ability in a functional ELISA. IGFLR1 may also be involved in the immune system as a member of the TNF receptor family. Studies have found that in colorectal cancer, IGFLR1 is highly expressed on the surface of CD8+ T cells and has the function of depleting T cells. Inhibiting the expression of IGFLR1 may slow the progression of colorectal cancer tumors. In colorectal cancer patients, CXCL13+TH1-like cells may affect the therapeutic effect of immune checkpoint inhibitors. IGFLR1 is a type of receptor protein that is highly expressed on CXCL13+TH1-like cells. In vitro experiments in vivo demonstrated that IGFLR1, as a co-stimulatory factor, may become a potential drug therapy target. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1 (CSB-MP764932HU), the EC50 is 32.33-47.52 ng/mL. |
Target Names | IGFLR1 |
Uniprot No. | Q9H665 |
Alternative Names | (Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 23-163aa |
Target Protein Sequence | SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP |
Mol. Weight | 17.4 kDa |
Protein Length | Partial |
Tag Info |
C-terminal 6xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database Links |
HGNC: 23620 OMIM: 614143 KEGG: hsa:79713 STRING: 9606.ENSP00000246532 UniGene: Hs.352548 |