Recombinant Human IL12P40&P19 Heterodimer Protein (Active)

In Stock
Code CSB-MP6494HU-WD
Abbreviation Recombinant Human IL12P40&P19 Heterodimer protein (Active)
MSDS
Size Inquiry
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is <0.5 μg/mL.
Target Names
IL-23
Uniprot No.
Alternative Names
SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-328aa(IL12P40)&20-189aa(P19)
Target Protein Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Mol. Weight
55.0 kDa (IL-23 single chain); 36.5 kDa (p40) & 18.5 kDa (p19)
Protein Length
Heterodimer
Tag Info
Tag free
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

IL-23, a heterodimeric cytokine composed of IL-12p40 and IL-23p19 subunits, drives Th17 differentiation and plays a central role in autoimmune and inflammatory disease models. This tag-free heterodimer, spanning residues 23–328 of IL-12p40 and 20–189 of IL-23p19, induces interferon gamma secretion in human NK-92 cells with an ED50 below 0.5 μg/mL, demonstrating potent signaling activity suitable for cell-based functional assays including T cell activation, Th17 polarization studies, and STAT3 phosphorylation experiments. The endotoxin level of ≤10 EU/mg meets the quality thresholds commonly required for primary immune cell assays, where LPS contamination would confound cytokine-specific responses. With purity exceeding 95% by SDS-PAGE, this heterodimer provides a validated reagent for dissecting IL-23/IL-17 axis signaling, evaluating therapeutic antibody candidates targeting IL-23p19, and serving as a positive control in cytokine detection platforms.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*