Home
Active Protein
Other
Recombinant Human IL12P40&P19 Heterodimer Protein (Active)

Recombinant Human IL12P40&P19 Heterodimer Protein (Active)

^{In Stock}

Code	CSB-MP6494HU-WD
Abbreviation	Recombinant Human IL12P40&P19 Heterodimer protein (Active)
MSDS	MSDS Datasheet
Size	Inquiry
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

≤10 EU/mg by the LAL method

Activity

Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is ＜0.5 μg/mL.

Target Names

IL-23

Uniprot No.

P29460 AAG37232

Alternative Names

SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

23-328aa(IL12P40)&20-189aa(P19)

Target Protein Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Mol. Weight

55.0 kDa (IL-23 single chain); 36.5 kDa (p40) & 18.5 kDa (p19)

Protein Length

Heterodimer

Tag Info

Tag free

Form

Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

IL-23, a heterodimeric cytokine composed of IL-12p40 and IL-23p19 subunits, drives Th17 differentiation and plays a central role in autoimmune and inflammatory disease models. This tag-free heterodimer, spanning residues 23–328 of IL-12p40 and 20–189 of IL-23p19, induces interferon gamma secretion in human NK-92 cells with an ED50 below 0.5 μg/mL, demonstrating potent signaling activity suitable for cell-based functional assays including T cell activation, Th17 polarization studies, and STAT3 phosphorylation experiments. The endotoxin level of ≤10 EU/mg meets the quality thresholds commonly required for primary immune cell assays, where LPS contamination would confound cytokine-specific responses. With purity exceeding 95% by SDS-PAGE, this heterodimer provides a validated reagent for dissecting IL-23/IL-17 axis signaling, evaluating therapeutic antibody candidates targeting IL-23p19, and serving as a positive control in cytokine detection platforms.