Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody (CSB-RA727848MA1HU), the EC50 is 0.9057-1.259 ng/mL.

Target Names

MUC17

Uniprot No.

Q685J3

Research Area

other

Alternative Names

(MUC-17)(Small intestinal mucin-3)(MUC-3)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

4131-4390aa

Target Protein Sequence

RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL

Mol. Weight

32.0kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Human MUC17 (Mucin-17) recombinant protein was produced in mammalian cell, where the gene sequence encoding human MUC17 (4131-4390aa) was expressed with the C-terminal 10xHis tag. The purity of this MUC17 protein was greater than 95% by SDS-PAGE. The activity was tested.

As a newly discovered mucin, MUC17 (Mucin-17) belongs to the membrane-bound mucin family. Mucins are highly O-glycosylated linear glycoproteins secreted by higher organisms to protect and lubricate epithelial cell surfaces and are involved in the regulation of immune responses, inflammation, adhesion, and tumorigenesis. MUC17 is present in epithelial cells in specific human tissues. Its functions in epithelial cells are primarily to provide cytoprotection, maintain luminal architecture, signal transduction, and confer anti-adhesion properties to cancer cells that have lost apical/basolateral polarization. The biological function of MUC17 is thought to be to maintain the integrity of the mucosal barrier in the gut, such as mucosal restoration.

Target Background

Function

Probably plays a role in maintaining homeostasis on mucosal surfaces.

Gene References into Functions

MUC17 polymorphisms are involved in endometriosis development and the associated infertility in the Taiwanese population. PMID: 26285705
Carbachol stimulated enterocyte MUC17 endocytosis is concomitant with NHE3 internalization and CFTR membrane recruitment. PMID: 23784542
The HIF1alpha-mediated hypoxic signal pathway contributes to MUC17 expression, and DNA methylation of hypoxia responsive element could be a determinant of the hypoxic inducibility of MUC17 in pancreatic cancer cells. PMID: 22970168
Both native and exogenous MUC17 play a role in attachment and invasion of enteroinvasive E. coli in colonic cell lines and in maintaining epithelial barrier function. PMID: 21393431
Hypomethylation status in the MUC17 promoter could be a novel epigenetic marker for the diagnosis of Pancreatic ductal adenocarcinomas. PMID: 20926598
Results indicate that the potential protective effects of this membrane-bound mucin are primarily or secondarily diminished in inflammatory and neoplastic conditions. PMID: 20702471
augments intestinal cell restitution and enhances healing of experimental colitis in mice PMID: 20211273
The authors demonstrate that apically atypical enteropathogenic Escherichia coli infection is followed by increased production of secreted MUC2 and MUC5AC mucins and membrane-bound MUC3 and MUC4 mucins. PMID: 20065027
sequence homology & chromosome mapping PMID: 11855812
surface localization of the smaller subunit of MUC17 is dependent on its N-glycosylation status PMID: 12888891
The MUC17 sequence has been extended toward its 5'-extremity to complete the sequence and localize the promoter and regulatory elements. PMID: 16737958
Pdzk1 plays a specific role in stabilizing Muc17 in the apical membrane of small intestinal enterocytes. PMID: 17990980

Hide All

Subcellular Location

[Isoform 1]: Cell membrane; Single-pass membrane protein.; [Isoform 2]: Secreted. Cell membrane.

Tissue Specificity

Expressed almost exclusively in the intestine. Expression is especially high in both the duodenum and transverse colon. Expressed in mature absorptive cells of the small intestinal villi. No expression is detected in goblet cells. Highly expressed in panc

Database Links

HGNC: 16800

OMIM: 608424

KEGG: hsa:140453

STRING: 9606.ENSP00000302716

UniGene: Hs.271819

Code	CSB-MP727848HU
Abbreviation	Recombinant Human MUC17 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$190
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Promotion
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Mucin-17 (MUC17), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage