Recombinant Human Mucin-17 (MUC17), partial (Active)

In Stock
Code CSB-MP727848HU
Abbreviation Recombinant Human MUC17 protein, partial (Active)
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody (CSB-RA727848MA1HU), the EC50 is 0.9057-1.259 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody (CSB-RA727848MA1HU), the EC50 is 0.9057-1.259 ng/mL.
Target Names
Uniprot No.
Research Area
other
Alternative Names
(MUC-17)(Small intestinal mucin-3)(MUC-3)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
4131-4390aa
Target Protein Sequence
RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL
Mol. Weight
32.0kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

MUC17 plays a critical role in epithelial barrier protection within the gastrointestinal tract, and this recombinant partial construct (aa 4131–4390) captures a functionally relevant segment of the extracellular domain. Activity validation by functional ELISA demonstrates robust antibody-binding capacity, with an EC50 of 0.91–1.26 ng/mL against a recombinant anti-MUC17 antibody when immobilized at 2 μg/mL — a result that supports use in antibody screening, epitope mapping, and sandwich ELISA development. Produced in mammalian cells with a C-terminal 10×His tag, this protein retains native-like post-translational modifications essential for accurate binding studies. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for both cell-based functional assays and as a reliable positive control in immunoassay optimization workflows.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probably plays a role in maintaining homeostasis on mucosal surfaces.
Gene References into Functions
  1. MUC17 polymorphisms are involved in endometriosis development and the associated infertility in the Taiwanese population. PMID: 26285705
  2. Carbachol stimulated enterocyte MUC17 endocytosis is concomitant with NHE3 internalization and CFTR membrane recruitment. PMID: 23784542
  3. The HIF1alpha-mediated hypoxic signal pathway contributes to MUC17 expression, and DNA methylation of hypoxia responsive element could be a determinant of the hypoxic inducibility of MUC17 in pancreatic cancer cells. PMID: 22970168
  4. Both native and exogenous MUC17 play a role in attachment and invasion of enteroinvasive E. coli in colonic cell lines and in maintaining epithelial barrier function. PMID: 21393431
  5. Hypomethylation status in the MUC17 promoter could be a novel epigenetic marker for the diagnosis of Pancreatic ductal adenocarcinomas. PMID: 20926598
  6. Results indicate that the potential protective effects of this membrane-bound mucin are primarily or secondarily diminished in inflammatory and neoplastic conditions. PMID: 20702471
  7. augments intestinal cell restitution and enhances healing of experimental colitis in mice PMID: 20211273
  8. The authors demonstrate that apically atypical enteropathogenic Escherichia coli infection is followed by increased production of secreted MUC2 and MUC5AC mucins and membrane-bound MUC3 and MUC4 mucins. PMID: 20065027
  9. sequence homology & chromosome mapping PMID: 11855812
  10. surface localization of the smaller subunit of MUC17 is dependent on its N-glycosylation status PMID: 12888891
  11. The MUC17 sequence has been extended toward its 5'-extremity to complete the sequence and localize the promoter and regulatory elements. PMID: 16737958
  12. Pdzk1 plays a specific role in stabilizing Muc17 in the apical membrane of small intestinal enterocytes. PMID: 17990980

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass membrane protein.; [Isoform 2]: Secreted. Cell membrane.
Tissue Specificity
Expressed almost exclusively in the intestine. Expression is especially high in both the duodenum and transverse colon. Expressed in mature absorptive cells of the small intestinal villi. No expression is detected in goblet cells. Highly expressed in panc
Database Links

HGNC: 16800

OMIM: 608424

KEGG: hsa:140453

STRING: 9606.ENSP00000302716

UniGene: Hs.271819

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*