Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody (CSB-RA727848MA1HU), the EC50 is 0.9057-1.259 ng/mL.
Alternative Names
(MUC-17)(Small intestinal mucin-3)(MUC-3)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
4131-4390aa
Target Protein Sequence
RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human MUC17 (Mucin-17) recombinant protein was produced in mammalian cell, where the gene sequence encoding human MUC17 (4131-4390aa) was expressed with the C-terminal 10xHis tag. The purity of this MUC17 protein was greater than 95% by SDS-PAGE. The activity was tested.
As a newly discovered mucin, MUC17 (Mucin-17) belongs to the membrane-bound mucin family. Mucins are highly O-glycosylated linear glycoproteins secreted by higher organisms to protect and lubricate epithelial cell surfaces and are involved in the regulation of immune responses, inflammation, adhesion, and tumorigenesis. MUC17 is present in epithelial cells in specific human tissues. Its functions in epithelial cells are primarily to provide cytoprotection, maintain luminal architecture, signal transduction, and confer anti-adhesion properties to cancer cells that have lost apical/basolateral polarization. The biological function of MUC17 is thought to be to maintain the integrity of the mucosal barrier in the gut, such as mucosal restoration.