Code | CSB-MP727848HU |
Size | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This Human MUC17 (Mucin-17) recombinant protein was produced in mammalian cell, where the gene sequence encoding human MUC17 (4131-4390aa) was expressed with the C-terminal 10xHis tag. The purity of this MUC17 protein was greater than 95% by SDS-PAGE. The activity was tested. As a newly discovered mucin, MUC17 (Mucin-17) belongs to the membrane-bound mucin family. Mucins are highly O-glycosylated linear glycoproteins secreted by higher organisms to protect and lubricate epithelial cell surfaces and are involved in the regulation of immune responses, inflammation, adhesion, and tumorigenesis. MUC17 is present in epithelial cells in specific human tissues. Its functions in epithelial cells are primarily to provide cytoprotection, maintain luminal architecture, signal transduction, and confer anti-adhesion properties to cancer cells that have lost apical/basolateral polarization. The biological function of MUC17 is thought to be to maintain the integrity of the mucosal barrier in the gut, such as mucosal restoration. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody (CSB-RA727848MA1HU), the EC50 is 0.9057-1.259 ng/mL. |
Target Names | MUC17 |
Uniprot No. | Q685J3 |
Research Area | other |
Alternative Names | (MUC-17)(Small intestinal mucin-3)(MUC-3) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 4131-4390aa |
Target Protein Sequence | RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL |
Mol. Weight | 32.0kDa |
Protein Length | Partial |
Tag Info |
C-terminal 10xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Probably plays a role in maintaining homeostasis on mucosal surfaces.
|
Gene References into Functions |
|
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass membrane protein.; [Isoform 2]: Secreted. Cell membrane. |
Tissue Specificity | Expressed almost exclusively in the intestine. Expression is especially high in both the duodenum and transverse colon. Expressed in mature absorptive cells of the small intestinal villi. No expression is detected in goblet cells. Highly expressed in panc |
Database Links |
HGNC: 16800 OMIM: 608424 KEGG: hsa:140453 STRING: 9606.ENSP00000302716 UniGene: Hs.271819 |