Recombinant Human Myosin regulatory light chain 12B (MYL12B) (Active)

In Stock
Code CSB-EP015308HUc7
Abbreviation Recombinant Human MYL12B protein (Active)
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human MYL12B at 2μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU),the EC50 is 19.290-28.646 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MYL12B at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU). The EC50 is 19.290-28.646 ng/mL.
Target Names
Uniprot No.
Alternative Names
MRLC2;MYLC2B
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-172aa
Target Protein Sequence
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Mol. Weight
26.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant human MYL12B protein (amino acids 1-172) is expressed in E. coli with a C-terminal 6×His tag, demonstrating high purity (>95% by SDS-PAGE) and low endotoxin levels (<1.0 EU/μg, LAL method). Functional validation via ELISA confirms its reactivity with anti-MYL9 antibody (CSB-RA015318MA1HU) (EC50: 19.290–28.646 ng/mL at 2 μg/mL immobilization), suggesting shared epitopes within the myosin light chain family. Provided as lyophilized powder, this recombinant MYL12B protein ensures stability and ease of use in biochemical assays. The His tag facilitates purification while preserving functional domains. This protein serves as a critical tool for investigating actomyosin dynamics, mechanotransduction pathways, and diseases associated with myosin light chain dysfunction.

The human MYL12B protein is a significant component of the myosin regulatory light chain family, playing a pivotal role in the regulation of non-muscle myosin II activity. Myosin light chains are crucial for muscle contractility as they modulate the ATPase activity of myosin motors, enabling muscle contractions and various forms of motility in non-muscle cells. Specifically, MYL12B, along with its counterparts MYL12A and MYL9, is implicated in processes such as cytokinesis and cell locomotion, highlighting its relevance to cellular dynamics during both normal and pathological conditions, including cancer progression [1].

Moreover, MYL12B's expression has been linked with various physiological and pathological states. For instance, during cardiac remodeling, MYL12B is down-regulated, with associated alterations in actomyosin proteins impacting the contractile function of cardiac tissues [2]. Additionally, the regulation and phosphorylation of MYL12B are critical for maintaining the stability of myosin II complexes and the structural integrity of cells, emphasizing its role in cellular mechanics and motility [3][4].

Notably, the dysregulation of MYL12B is associated with cancer, as elevated expression levels have been observed in cancerous tissues, pointing to its potential function as a prognostic biomarker for conditions such as pancreatic ductal adenocarcinoma [1][5]. In vascular smooth muscle cells, MYL12B is particularly important for contractility and remodeling, responding dynamically to various stimuli, suggesting its functional versatility [6].

References:
[1] O. Menyhárt, Á. Bartha, & B. Győrffy. Preserved correlation matrices pinpoint extracellular matrix organization as a critical factor in pancreatic ductal adenocarcinoma. F1000research, vol. 12, p. 418, 2023. https://doi.org/10.12688/f1000research.131414.1
[2] S. Nordmeyer, M. Kraus, et al. Disease- and sex-specific differences in patients with heart valve disease: a proteome study. Life Science Alliance, vol. 6, no. 3, p. e202201411, 2023. https://doi.org/10.26508/lsa.202201411
[3] K. Limbutara, A. Kelleher, C. Yang, V. Raghuram, & M. Knepper. Phosphorylation changes in response to kinase inhibitor h89 in pka-null cells. Scientific Reports, vol. 9, no. 1, 2019. https://doi.org/10.1038/s41598-019-39116-2
[4] I. Park, C. Han, et al. Myosin regulatory light chains are required to maintain the stability of myosin ii and cellular integrity. Biochemical Journal, vol. 434, no. 1, p. 171-180, 2011. https://doi.org/10.1042/bj20101473
[5] H. Li, Y. Han, et al. Combined mendelian randomization and quantitative proteomics analysis to study the influence of thyroid dysfunction on acute ischemic stroke. Medcomm – Future Medicine, vol. 3, no. 4, 2024. https://doi.org/10.1002/mef2.70002
[6] X. Hu, L. You, et al. Effects of β‑hydroxybutyric acid and ghrelin on the motility and inflammation of gastric antral smooth muscle cells involving the regulation of growth hormone secretagogue receptor. Molecular Medicine Reports, 2019. https://doi.org/10.3892/mmr.2019.10739

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Phosphorylation triggers actin polymerization in vascular smooth muscle. Implicated in cytokinesis, receptor capping, and cell locomotion.
Gene References into Functions
  1. phosphorylated MRLC temporally controls its own accumulation, but not that of actin, in cultured mammalian cells. PMID: 22374324
  2. The study data show that manipulation of the activation sites (Thr18/Ser19) significantly alters myosin II function in a number of these assays while manipulation of the putative inhibitory sites (Ser1/Ser2/Thr9) does not. PMID: 22136066
  3. These results suggest that 2P-MRLC has a role different from that of 1P-MRLC at the midzone, and is not a subunit of myosin II. PMID: 22166199
  4. These results suggest that EGCG inhibits the cell growth by reducing the MRLC phosphorylation and this effect is mediated by the 67LR. PMID: 15946647
Tissue Specificity
Ubiquitously expressed in various hematopoietic cells.
Database Links

HGNC: 29827

KEGG: hsa:103910

STRING: 9606.ENSP00000237500

UniGene: Hs.190086

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*