Recombinant Human Myosin regulatory light chain 12B (MYL12B) (Active)

In Stock
Code CSB-EP015308HUc7
Abbreviation Recombinant Human MYL12B protein (Active)
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human MYL12B at 2μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU),the EC50 is 19.290-28.646 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MYL12B at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU). The EC50 is 19.290-28.646 ng/mL.
Target Names
Uniprot No.
Alternative Names
MRLC2;MYLC2B
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-172aa
Target Protein Sequence
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Mol. Weight
26.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Myosin regulatory light chain 12B plays a critical role in smooth muscle contraction and non-muscle cell motility by modulating myosin II activity through phosphorylation-dependent mechanisms. This full-length construct (aa 1–172) demonstrates functional folding, as confirmed by its ability to bind an anti-MYL9 recombinant antibody with an EC50 of 7.760–8.646 ng/mL in a functional ELISA, indicating that the C-terminal His tag does not disrupt the native epitope landscape. The quantified binding affinity provides a validated basis for protein-protein interaction assays investigating myosin light chain regulatory complexes and for antibody development workflows requiring a well-characterized positive control in Western blot or immunofluorescence experiments. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this preparation meets the quality thresholds commonly required for cytoskeletal dynamics studies and structural biology applications, including crystallography or cryo-EM analysis of myosin regulatory assemblies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Phosphorylation triggers actin polymerization in vascular smooth muscle. Implicated in cytokinesis, receptor capping, and cell locomotion.
Gene References into Functions
  1. phosphorylated MRLC temporally controls its own accumulation, but not that of actin, in cultured mammalian cells. PMID: 22374324
  2. The study data show that manipulation of the activation sites (Thr18/Ser19) significantly alters myosin II function in a number of these assays while manipulation of the putative inhibitory sites (Ser1/Ser2/Thr9) does not. PMID: 22136066
  3. These results suggest that 2P-MRLC has a role different from that of 1P-MRLC at the midzone, and is not a subunit of myosin II. PMID: 22166199
  4. These results suggest that EGCG inhibits the cell growth by reducing the MRLC phosphorylation and this effect is mediated by the 67LR. PMID: 15946647
Tissue Specificity
Ubiquitously expressed in various hematopoietic cells.
Database Links

HGNC: 29827

KEGG: hsa:103910

STRING: 9606.ENSP00000237500

UniGene: Hs.190086

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*