Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU), the EC50 is 2.417-2.971 ng/mL.

Target Names

ACVRL1

Uniprot No.

P37023

Alternative Names

ACVRLK1;ALK1;

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

22-118aa

Target Protein Sequence

DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ

Mol. Weight

11.5KDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant human serine/threonine-protein kinase receptor R3 (ACVRL1) is an active protein generated in the baculovirus-infected insect cell expression system. The gene fragment encoding the 22-118aa of the human ACVRL1 protein was fused with the 6xHis-tag gene at the C-terminus and then cloned into the baculovirus transfer vector. The resulting ACVRL1 gene-containing vector was co-transfected into the cells with the baculovirus packaging mix to obtain the ACVRL1 gene-containing recombinant virus particles. Insect cells were infected with the recombinant bacmid, and transfected insect cells were selected through antibiotic screening and then cultured to harvest the recombinant human ACVRL1 protein. The purity of this protein is over 95% measured by SDS-PAGE. It contains low endotoxin, less than 1.0 EU/ug determined by the LAL method. Its activity was validated through a functional ELISA. Immobilized human CVRL1 at 2 μg/mL can bind the anti-ACVRL1 recombinant antibody (CSB-RA001262MA1HU), with the EC₅₀ of 2.417-2.971 ng/mL.

ACVRL1, the endothelial cell-specific type I receptor of the TGF-β superfamily, is primarily expressed in vascular endothelial cells and plays a crucial role in the regulation of normal vascular development and remodeling, as well as pathological tumor angiogenesis. ACVRL1 controls a series of genes related to cancer cell survival, proliferation, angiogenesis, invasion, and metastasis, exerting a significant role in inhibiting the expression of key immune activation regulators and promoting the production of immune suppression factors. Therefore, targeting the ACVRL1 signaling pathway has become a promising strategy for anti-angiogenic cancer therapy. Developing active ACVRL1 proteins is of great significance in further studying its function and developing tumor drugs.

Target Background

Function

Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.

Gene References into Functions

Heterozygous SNP, rs372023206, was found in all tested patients with idiopathic pulmonary hypertension (heterozygosity). PMID: 29350394
ENG, ACVRL1, and SMAD4 mutations result in different phenotypes in hereditary hemorrhagic telangiectasia PMID: 30251589
ENG mutation carriers were more likely than ACVRL1 mutation carriers to have pAVMs (P < 0.001) or multiple lesions (P = 0.03), and to undergo procedural intervention (P = 0.02). The HHT severity score was significantly higher in ENG than in ACVRL1 (P = 0.02). PMID: 29048420
These studies identified pathways mediating LDLR-independent uptake of LDL may provide unique opportunities to block the initiation of LDL accumulation in the vessel wall or augment hepatic LDLR-dependent clearance of LDL. PMID: 27869117
We have identified a novel role for ALK1 in cardiac remodeling PMID: 28820968
The present study showed that deletion-duplication mutations in the BMPR2 or ACVRL1 genes may not be associated with non-regression of Pulmonary arterial hypertension. PMID: 28290170
Study identified 2 non-synonymous missense mutations: c.C652T, p.R218W in ACVRL1, c.C717G, p.D239E in SGCD in Chinese population with total anomalous pulmonary venous return. PMID: 28412737
Mutations in ACVRL1 gene encoding for transforming growth factor (TGF)-[beta] superfamily have been identified in Pulmonary Arterial Hypertension. PMID: 28582316
Treatment-related telangiectasia was noted in 7% of patients, suggesting in vivo inhibition of the ALK-1 pathway. PMID: 26655846
Data indicate that simultaneous targeting of molecules that control distinct phases of angiogenesis, such as ALK1 and VEGFR, is a valid strategy for treatment of metastatic renal cell carcinoma (mRCC). PMID: 27248821
Study showed that rs706819, rs2293094, and rs11169953 polymorphisms in the ACVRL1 gene are associated with higher susceptibility to brain arteriovenous malformations. PMID: 28927913
c.1027C > T(p.Gln343) mutation within the ACVRL1 gene in family with hereditary hemorrhagic telangiectasia PMID: 27381467
Bone morphogenetic protein (BMP)9 and BMP10 are high affinity ligands for activin receptor-like kinase 1 (ALK1). PMID: 27528761
Activin receptor-like kinase (ALK)1 is a transforming growth factor beta (TGF-beta) type I receptor predominantly expressed in actively proliferating endothelial cells (ECs). PMID: 27528762
Two novel missense mutations and two recurrent mutations in the ACVRL1 gene are associated with pulmonary arterial hypertension in in Chinese families. PMID: 27316748
ALK1 expression and microvessel density are increased in oral lichen planus , particularly in atrophic/erosive OLP type. PMID: 26662187
The genetic-interactions among BMPR-2, ALK-1, and 5-HTT polymorphisms, elevated BMP-2 and 5-HT levels and differential gene expression substantiated the strong genetic contribution in high altitude pulmonary edema pathophysiology. PMID: 27196063
Study of four patients with pulmonary arterial hypertension associated with human immunodeficiency virus infection found predisposing mutations in the BMPR2, ACVRL1 and ENG genes. PMID: 26897508
The preponderance of ACVRL1 mutations was due to founder mutations, specifically, c.830C>A (p.Thr277Lys), which was found in 24 families from the same geographical area of Norway. PMID: 25970827
Report interaction between ALK1 signaling and connexin40 in the development of arteriovenous malformations. PMID: 26821948
Short hairpin-mediated downregulation of either ALK5 or ALK1 resulted in a strong inhibition of TGFbeta-induced chondrogenesis. PMID: 26720610
This work was designed to examine the pathogenicity of 23 nucleotide variations in ACVRL1 gene detected in more than 400 Hereditary Hemorrhagic Telangiectasia syndrome patients. PMID: 26176610
The ACVRL1 c.314-35A>G polymorphism is associated with organ vascular malformations in hereditary hemorrhagic telangiectasia patients with ENG mutations, but not in patients with ACVRL1 mutations. PMID: 25847705
bone morphogenic proteins within the serum of cell culture medium are potent inducers of endothelial Hey1 and Hey2 gene expression within the first few hours after medium change PMID: 25799559
endoglin and ALK1 have been identified as potential therapeutic targets for antibody treatment in various cancers. PMID: 25279424
Mutations in ACVRL1 gene is not associated with pulmonary arterial hypertension. PMID: 24936649
In chronic subdural hematomas, the expression of ALK-1 was slightly increased in the dura and markedly up-regulated in the outer membrane. PMID: 24305026
P7170 inhibited the phosphorylation of AKT1. PMID: 25466244
Endoglin and ACVRL1 contribute to several novel networks, including TGF-beta dependent and independent ones, critical for vascular function and potentially defective in hereditary hemorrhagic telangiectasia. PMID: 24319055
Results do not replicate the association between polymorphism in ACVRL1 protein and BAVM in this Dutch population. PMID: 24323303
Results show that mutations of ACVRL-1 protein is a genetic predisposing factor for HHT associated PH in Chinese patients PMID: 23919827
Consistent with the aberrant upregulation of ACVRL1 and downstream Smad signaling, abrogation of EDD led to deregulated vessel development and endothelial cell motility. PMID: 24189493
shows role of ALK-1 in many process related to cardiovascular homeostasis, and the involvement of this protein in the development of cardiovascular diseases, suggesting the possibility of using the ALK-1/smad-1 pathway as a powerful therapeutic target PMID: 23707512
A novel intron mutation in ACVRL1 gene is associated with familial hereditary hemorrhagic telangiectasia. PMID: 23460919
The balance in signalling through either ALK-1 or ALK-5 regulates leptin expression in mesenchymal stem cells. PMID: 22087763
ACVRL1 gene expression is significantly corellated with advanced tumor stages and it is a useful marker for prognosis. PMID: 23447486
Defective trafficking and retention in the endoplasmic reticulum of mutant ALK1 protein is a possible mechanism of hereditary haemorrhagic telangiectasia type 2 in some patients. PMID: 23124896
ALK1 is upregulated in endothelial cells during vascular injury by a synergistic cooperative mechanism between KLF6 and specificity protein 1. PMID: 23048070
Alk1 interacts with cav-1 in human dermal fibroblasts and Transforming Growth Factor beta enhances this association. PMID: 22277251
Inheritance of ACVRL1 single nucleotide polymorphisms marginally contributed to the risk of cutaneous telangiectasiae. PMID: 22677372
The abnormal expression of ALK1 and TGFbR2 were found to be independent contributors to nasopharyngeal carcinogenesis. PMID: 22391627
Patients with childhood idiopathic pulmonary arterial hypertension or heritable pulmonary arterial hypertension with ALK1 mutation carriers tended to have worse outcomes than mutation noncarriers. PMID: 22632830
The structure reveals that the high specificity of ALK1 for BMP9/10 is determined by a novel orientation of ALK1 with respect to BMP9, which leads to a unique set of receptor-ligand interactions PMID: 22718755
Alk1 extracellular domain binds with high affinity to BMP-9. PMID: 22799562
data suggest that both the VEGF/VEGF receptor and the BMP9/ALK1 pathways are essential for stimulating angiogenesis, and targeting both pathways simultaneously may be an attractive strategy to overcome resistance to antiangiogenesis therapy PMID: 22493445
PTPN14 has a role in angiogenesis and/or arteriovenous fate, acting via EphrinB2 and ACVRL1/activin receptor-like kinase 1 PMID: 22233626
Two angiogenesis-associated transcripts (Egfl7 and Acvrl1) showed lower expression in early-onset PE versus late-onset pre-eclampsia and versus gestational age-matched controls. PMID: 22013081
insight into the potential structure of ALK1(EC) and into the structural effects of type 2 Hereditary Haemorrhagic Telangiectasia associated mutations PMID: 22028876
A novel endoglin mutation (c.1-127C > T); and a novel ACVRL1 mutation (c.252_253insC; p.Val85fsX168). It was shown for the first time that a 5'-UTR mutation can prevent translation of endoglin among hereditary hemorrhagic telangiectasia patients. PMID: 21967607
Studies indicate that mutations in at least five genes are thought to result in hereditary hemorrhagic telangiectasia, but mutations in ENG and ACVRL1/ALK1 cause approximately 85% of cases. PMID: 21546842

Hide All

Involvement in disease

Telangiectasia, hereditary hemorrhagic, 2 (HHT2)

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily

Database Links

HGNC: 175

OMIM: 600376

KEGG: hsa:94

STRING: 9606.ENSP00000373574

UniGene: Hs.591026

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-BP001262HU1
MSDS	MSDS
Size	$352
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU)，the EC₅₀ is 2.417-2.971 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Serine/threonine-protein kinase receptor R3 (ACVRL1), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage