Recombinant Human UL16-binding protein 2 (ULBP2), partial (Active)

Discontinued
Code CSB-AP005521HU
MSDS
Size $184
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human ULBP-2 in functional ELISA is less than 30 ug/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
ALCAN alpha; ALCAN-alpha; N2DL 2; N2DL-2; N2DL2; N2DL2_HUMAN; NKG2D ligand 2; NKG2D ligand 2 precursor; NKG2DL2; RAET1H; Retinoic acid early transcript 1 H; Retinoic acid early transcript 1H; UL16 binding protein 2; UL16-binding protein 2; ULBP2
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
26-217aa
Complete Sequence
GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
Mol. Weight
51.4 kDa
Protein Length
Partial
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Discover the power of Recombinant Human ULBP2, a high-quality protein engineered for immunology research applications. This partial-length protein encompasses the 26-217aa expression region of UL16-binding protein 2, a crucial component in the immune system's intricate network. Produced in mammalian cells and featuring a C-terminal Fc-tag for simplified purification, Recombinant Human ULBP2 is perfect for researchers seeking a dependable source of ULBP2 protein.

Our Recombinant Human ULBP2 exhibits a purity of greater than 90% as verified by SDS-PAGE, ensuring the protein will deliver optimal performance in your experiments. Furthermore, the endotoxin levels are less than 1.0 EU/µg as determined by the LAL method, guaranteeing minimal interference with your work. The activity of this protein has been assessed by its ability to bind Human ULBP-2 in functional ELISA, with an ED50 of less than 30 µg/ml, demonstrating a high level of biological activity.

Supplied as a lyophilized powder, Recombinant Human ULBP2 offers convenient storage and use for a variety of experimental setups. Choose this protein for a reliable and effective solution for your research needs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
Gene References into Functions
  1. High ULBP2 expression is associated with lymphoma. PMID: 27477692
  2. IMP3 directly interacts with ULBP2 mRNA, leading to ULBP2 transcript destabilization and reduced ULBP2 surface expression and indirectly downregulates MICB with a mechanism functionally distinct from that of ULBP2. PMID: 26982091
  3. By suppressing AR and up-regulating ULBP2 in HCC, cisplatin could up-regulate cytotoxicity of NK cells to better target HCC. PMID: 26805759
  4. human tumor cells lost their surface expression of ULBP2, but not ULBP1 and ULBP3, during NK cell-mediated cytolysis. PMID: 24614922
  5. This study suggests that NKG2D ligands shedding of MICA, MICB and ULBP-2 is a novel pathway in endometriosis complex pathogenesis that impairs Natural Killer Cells cell function. PMID: 25775242
  6. A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2. PMID: 25983110
  7. NKG2D and NKG2DL are involved in allergen-induced activation of dendritic epidermal T cells and the NKG2D/NKG2DL pathway might be a potential target for treatment of contact hypersensitivity. PMID: 25634359
  8. Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells. PMID: 25212604
  9. Data inticate that heat shock protein 60 (HSP60) interacted constitutively with NKG2D ligand ULBP2 and phosphatase of regenerating liver 3 (PRL-3) regulated HSP60 tyrosine phosphorylation. PMID: 25687758
  10. Results suggest that ULBP2 is expressed and released from cervical cancer cells by CRF, which regulates NKG2D expression in natural killer cells. PMID: 24841552
  11. c-Cbl regulates MICA- but not ULBP2-induced NKG2D down-modulation in human NK cells. PMID: 24846123
  12. the NKG2D ligand ULBP2 is transported to the cell surface through an endosomal pathway dependent on protein kinase C and lysosomal integrity. ULBP2 surface transport is dependent on the invariant chain. PMID: 25024379
  13. Vpr augments ULBP2 expression on both infected and uninfected bystander cells during HIV-1 infection of primary CD4+ T lymphocytes. PMID: 23726848
  14. Study shows that tumor-suppressive miR-34a and miR-34c act as ULBP2 repressors. Findings also implicate p53 in ULBP2 regulation, emphasizing the role of the specific NKG2DL in tumor immune surveillance. PMID: 22102694
  15. Data show that VSV infection caused an active suppression of NKG2D-ligand surface expression, affecting both endogenous and histone deacetylase (HDAC)-inhibitor induced MICA, MICB and ULBP-2 expression. PMID: 21857986
  16. Findings define the involvement of p53 in the regulation of ULBP1 and ULBP2 which enhance NK cell-mediated target recognition. PMID: 21764762
  17. analysis of the area under receiver operating characteristic curves showed that ULBP2 was superior to CA 19-9 in discriminating patients with early-stage PC from healthy controls PMID: 21625447
  18. The human NKG2D ligand ULBP2 can be expressed at the cell surface with or without a GPI anchor and both forms can activate NK cells PMID: 21224393
  19. Data show that IL-32alpha stimulates Fas and ULBP2 expression via activation of p38 MAPK, which increases NK susceptibility of chronic myeloid leukemia cells. PMID: 21321117
  20. it was shown that high expression of several NKG2D ligands is inversely correlated with ovarian cancer survival PMID: 20054857
  21. Levels of soluble ULBP2 were significantly increased in B-cell chronic lymphocytic leukemia. PMID: 20428196
  22. ULBP2 binds to the NKG2D receptor and activates multiple signaling pathways in primary natural killer cells. PMID: 11777960
  23. Human cytomegalovirus induces the expression of ULBP2, which is predominantly localized in the endoplasmic reticulum of infected fibroblasts together with viral protein UL16. PMID: 12847260
  24. These findings identify NKG2D ligands as targets of leukemia differentiation therapy PMID: 17391757
  25. IL-18 treatment increased ULBP2 expression in leukemia cells at the mRNA and protein levels PMID: 18706445
  26. ULBP2 was seen on 82.9% of ovarian cancer cells but not on normal ovarian epithelium. Strong expression of ULBP2 in these cells correlated with less intraepithelial infiltration of T cells & may relate to T cell dysfunction in the tumor microenvironment. PMID: 18791713
  27. IFN-gamma, by down-regulating ligand expression, might facilitate escape of MHC class I-negative melanoma cells from NKG2D-mediated killing by NK cells. PMID: 19089914
  28. administration of ATRA or sodium valproate to patients affected with acute myeloid leukaemia M3 or M1 respectively, leads to the induction of transcription and expression of NKG2D-L at the surface of leukaemic cells. PMID: 19151770
  29. RAET1G, like ULBP2, appears broadly expressed, but exhibits a lower apparent avidity for NKG2D due to a mutation in the center of the MHC-like fold. PMID: 19424970
  30. Data show upon HSV-1 infection of cell lines, surface levels of NKG2D ligands MICA antigen and UL16 binding protein 2 were downmodulated due to late viral ICP0 gene product(s). PMID: 19508374
  31. Only sULBP2 is an independent predictor of prognosis, the significance of which is superior to the well-established and widely used melanoma serum marker S100B. PMID: 19671853

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum. Secreted.
Protein Families
MHC class I family
Tissue Specificity
Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.
Database Links

HGNC: 14894

OMIM: 605698

KEGG: hsa:80328

STRING: 9606.ENSP00000356320

UniGene: Hs.656778

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*