Recombinant Macaca fascicularis Interleukin-21 receptor (IL21R), partial (Active)

In Stock
Code CSB-MP7140MOV
Abbreviation Recombinant Cynomolgus monkey IL21R protein, partial (Active)
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    ①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL21R at 2 μg/ml can bind Human IL21 (CSB-MP872537HU). The EC50 is 15.01-19.43 ng/mL. Biological Activity Assay
  • Activity
    Human IL21 (CSB-MP872537HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL21R with an affinity constant of 1.31 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL21R at 2 μg/mL can bind Human IL21 (CSB-MP872537HU). The EC50 is 15.01-19.43 ng/mL.
②Human IL21 (CSB-MP872537HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL21R with an affinity constant of 1.31 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
Uniprot No.
Alternative Names
Interleukin-21 receptor; Novel interleukin receptor
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
41-253aa
Target Protein Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNVTDHSGNYTQECGSFLLADSIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKE
Mol. Weight
26.2 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

IL-21 receptor signaling plays a pivotal role in T cell and NK cell differentiation, making the extracellular domain (aa 41–253) a critical tool for dissecting cytokine-mediated immune responses in preclinical primate models. Expressed in mammalian cells to preserve native glycosylation and disulfide architecture, this C-terminally His-tagged protein demonstrates quantified binding to human IL-21 with an EC50 of 15.01–19.43 ng/mL in functional ELISA and a KD of 1.31 nM by surface plasmon resonance, providing validated performance for ligand-receptor interaction studies and competitive inhibition assays. These affinity metrics support its use in therapeutic antibody epitope mapping, blocking antibody screening, and small-molecule inhibitor discovery campaigns targeting IL-21 signaling pathways implicated in cancer immunology. The protein meets the purity and endotoxin criteria typical for quantitative binding assays (>95% pure, <1.0 EU/μg), aligning with standards expected in SPR, biolayer interferometry, and high-throughput screening workflows.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*