Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus SLC39A6 at 2 μg/mL can bind Anti-SLC39A6 recombinant antibody (CSB-RA621669MA1HU). The EC50 is 0.8290-0.9864 ng/mL.

Target Names

SLC39A6

Uniprot No.

XP_005586923.1

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Baculovirus

Expression Region

21-309aa

Target Protein Sequence

LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Mol. Weight

33.6 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

ZIP6 (SLC39A6) mediates zinc influx across cellular membranes and has been implicated in tumor progression and metastasis, making it a relevant target for cancer biology investigations. This partial extracellular domain construct (aa 21–309) demonstrates robust antibody-binding activity in functional ELISA, with an EC50 of 0.83–0.99 ng/mL when immobilized at 2 μg/mL and challenged with anti-SLC39A6 recombinant antibody, confirming that the recombinant protein retains native epitope presentation. The quantified binding kinetics support its use in antibody development workflows, including hybridoma screening, epitope mapping, and as a calibration standard in immunoassays targeting ZIP6. Produced in baculovirus-infected insect cells with a C-terminal 6xHis tag, the protein exceeds 95% purity by SDS-PAGE and contains less than 1.0 EU/μg endotoxin, satisfying the quality criteria typical for ligand-binding assays and biophysical characterization studies where low contaminant levels are essential.

Code	CSB-BP5043MOV
Abbreviation	Recombinant Cynomolgus monkey SLC39A6 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$472
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus SLC39A6 at 2 μg/ml can bind Anti-SLC39A6 recombinant antibody (CSB-RA621669MA1HU). The EC₅₀ is 0.8290-0.9864 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1(SLC39A6),partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage