Recombinant Mouse Ephrin-A1 (Efna1), partial (Active)

Discontinued
Code CSB-AP005771MO
MSDS
Size $48
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human EphA2 in functional ELISA is less than 20 ug/ml.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Efna1; Epgl1; Epl1; Lerk1; Ephrin-A1; EPH-related receptor tyrosine kinase ligand 1; LERK-1; Immediate early response protein B61) [Cleaved into: Ephrin-A1; secreted form]
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
19-182aa
Complete Sequence
DRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYS
Mol. Weight
47.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-hFc-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.
Gene References into Functions
  1. EphA2 mAb treatment could partially inhibit LPSinduced inactivation of EphBEphrin B3 signalling, while Ephrin B3 overexpression could abrogate LPSinduced activation of EphA2Ephrin A1 signalling. EphB1/Ephrin B3 signalling may antagonise the EphA2/Ephrin A1dependent pathway following LPS treatment. PMID: 29901151
  2. Collectively, these data suggest that ATRA attenuates bleomycin-induced pulmonary fibrosis by regulating EphA2-EphrinA1 and PI3K-Akt signaling. PMID: 28743499
  3. Lipopolysaccharide exposure significantly up-regulated EphA2 and EphrinA1 expression. PMID: 27549114
  4. Activation of EphA1-Epha receptor axis attenuates diabetic nephropathy in mice. PMID: 28341121
  5. Following ephrin-A1 stimulation, truncated EphA2 did not detectably interfere with the phosphorylation of endogenous EphA2, and it potentiated cell adhesion possibly through modulation of integrin avidity. PMID: 27665280
  6. ADAM12 enhanced ephrin-A1 cleavage in response to transforming growth factor-betra1 in primary tumors. PMID: 23686306
  7. S100A8 and ephrin-A1 contribute to lung metastasis. PMID: 24103748
  8. We used in utero electroporation-mediated EphA7 overexpression in developing somatosensory corticothalamic axons to dissect EphA7/ephrin-A-dependent mechanisms involved in regulating both initial targeting and postnatal growth of the CT projections. PMID: 22821544
  9. Elevated levels of ephrin-A1 may contribute to diabetic keratopathies by persistently engaging EphA2 and prohibiting Akt-dependent corneal epithelial repair processes. PMID: 22247486
  10. Data indicate that ephrin-A1 regulates cardiac valve development, making ephrin-A1-deficient mice a novel model for congenital heart defects. PMID: 20960543
  11. Cooperation between Slit2 and ephrin-A1 regulates a balance between the pro- and antiangiogenic functions of Slit2. PMID: 21135133
  12. ephrin-A1 has a positive role in tumor growth in vivo, and are consistent with previous reports of ephrin-A1 acting through EphA receptors in the tumor microenvironment in vivo. PMID: 20154726
  13. When NIH3T3 cells were plated onto an ephrinA1-coated surface, the cells both adhered and spread. PMID: 12134157
  14. Immunohistological analyses reveal strong ephrin-A1 expression in lung tissue, low expression in cortical areas of lymph nodes, and none in T cell/B cell areas of the spleen. PMID: 14707054
  15. Whole-mount in situ hybridization revealed overlapping expression of the Epha1 receptor and its high-affinity ligands ephrin A1 (Efna1) and ephrin A3 (Efna3) in the primitive streak and the posterior paraxial mesoderm during early mouse development. PMID: 16466970
  16. Ephrins A1 and A5 are substrates for a cross-linking enzyme, tissue transglutaminase, which mediates the formation of oligomeric ephrin. PMID: 17707797
  17. Increased expression of ephrin-A1 accelerated the malignant progression of the intestinal adenoma to invasive tumors. PMID: 18246128
  18. HIF-2alpha plays an essential role in vascular remodeling during tumor vascularization through activation of at least ephrin A1. PMID: 18434321
  19. Radiotherapy-induced changes in ephrin-A1 gene expression related with angiogenesis may modulate microenvironment and influence responsiveness of tumors. PMID: 18997097

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.; [Ephrin-A1, secreted form]: Secreted.
Protein Families
Ephrin family
Tissue Specificity
Expressed in myogenic progenitor cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*