Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr (CSB-MP025270MO) at 5 μg/mL can bind Mouse Rbp4, the EC₅₀ is 38.07-75.83 ng/mL.

Target Names

Rbp4

Uniprot No.

Q00724

Alternative Names

(Plasma retinol-binding protein)(PRBP)(RBP)

Molecular Characterization

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

19-201aa

Target Protein Sequence

ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Mol. Weight

50.3 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Retinol-binding protein 4 serves as the principal carrier of retinol in plasma and signals through interactions with transthyretin (Ttr) to prevent renal filtration, making its binding competence a critical functional benchmark. This recombinant mouse Rbp4 (residues 19–201, full-length mature protein) demonstrates confirmed Ttr-binding activity with an EC50 of 38.07–75.83 ng/mL in functional ELISA, verifying the conformational integrity required for ligand-binding and cargo-release assays, drug-protein interaction studies, and use as a quantitative ELISA standard. Expressed in mammalian cells with a C-terminal hFc1 tag, the protein supports antibody development campaigns and structural or biophysical characterization where native-like folding is essential. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based membrane transporter functional assays and cancer biology research involving retinoid signaling pathways.

Target Background

Function

Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.

Gene References into Functions

RBP4 is involved in all-trans retinoic acid-induced cleft palate. PMID: 28849085
RBP4-induced inflammation is largely mediated by TLR4. PMID: 28400700
New insights into ghrelin cell physiology, and given the known functions of RBP4 and TTR, support an emerging role for the ghrelin cell in blood glucose handling and metabolism. PMID: 23840311
Retinal degeneration in RBP4-Tg mice is RBP4-dependent and light-independent. PMID: 28813718
Rbp4-deficient mice accumulated retinol in the liver but it was undetectable in the serum, indicating an inverse relation between serum and liver retinol levels. RBP4 is critical for the mobilization of retinol from hepatic storage pools, and such mobilization is necessary for ocular development and visual function. PMID: 26974396
Hepatocytes Are the Principal Source of Circulating RBP4 in Mice PMID: 27797907
RBP4 may be a critical modulator promoting the vicious cycle of insulin resistance and heart failure by activating TLR4/MyD88-mediated inflammatory pathways. Potentially, lowering RBP4 might break the vicious cycle and improve both insulin resistance and cardiac hypertrophy. PMID: 27100622
Data (including data from studies in knockout mice) suggest that Rbp4 (plasma retinol-binding protein 4) is critical for antigen presentation and activation of CD4-positive T-lymphocyte in development of insulin resistance in mice obese due to high-fat diet. PMID: 26936962
A novel mechanism for circadian regulation of RBP4, but also a critical role of RBP4, acting as a hepatokine in the regulation of glucose metabolism by the circadian clock. PMID: 26564180
Elevated serum RBP4 raises BP. PMID: 25911613
These data show that decreasing circulating TTR levels or altering TTR-RBP4 binding could be a potential therapeutic approach for the treatment of type 2 diabetes. PMID: 25524914
findings suggest that RBP4 impaired in vivo adipogenesis, partly through the repression of the insulin pathway PMID: 24590924
The data implicate the involvement of chondrocytic Rbp4 in bone growth, particularly in the formation of the secondary ossification center of the limb. PMID: 23224267
STRA6 in tissues other than the eye appears to be the coupling of circulating holo-RBP levels to cell signaling, in turn regulating key processes such as insulin response. PMID: 23839944
expression of RBPR2 in liver and fat suggests a possible role in mediating established metabolic actions of RBP4 in those tissues PMID: 23105095
TTR blocks the ability of holo-retinol-binding protein to associate with STRA6 and thereby effectively suppresses both STRA6-mediated retinol uptake and STRA6-initiated cell signaling. PMID: 22826435
Suggest that RBP4 may be involved in the dyslipidemia associated with polycystic ovary syndrome in nonobese adolescents and that there may be an independent relationship between RBP4 and triglycerides but not between RBP4 and insulin resistance. PMID: 22341881
RBP4 is not only an adipocytokine, but also a hepatic cytokine leading to metabolic syndrome, non-alcoholic fatty liver disease and type 2 diabetes. PMID: 21983273
results indicate that rimonabant may improve vascular function by modulating RBP4 along with pro-inflammatory cytokines PMID: 21585349
Basal and cyclic AMP-induced Rbp4 transcription is regulated by a multiprotein complex that is similar to ones that modulate expression of genes of steroid hormone biosynthesis. PMID: 19389484
RBP4 is an adipocyte-derived 'signal' that may contribute to the pathogenesis of type 2 diabetes PMID: 16034410
Lowering transthyretin(TTR) levels or interfering with RBP4-TTR binding may enhance insulin sensitivity in obesity and type 2 diabetes PMID: 18285525
These results reveal a selective effect of all-trans retinoic acid inhibiting RBP4 expression specifically in adipocytes. PMID: 18769064
Identification and characterization of a non-retinoid ligand for retinol-binding protein 4 which lowers serum retinol-binding protein 4 levels in vivo. PMID: 19147488
HMGA1 is an important modulator of RBP4 gene expression in vivo. PMID: 19460132
Although mice lacking HMGA1 are diabetic and express very low levels of the insulin receptor, they have increased insulin sensitivity. Changes in circulating Rbp4 might partly account for this paradox. [REVIEW] PMID: 19664187

Hide All

Subcellular Location

Secreted.

Protein Families

Calycin superfamily, Lipocalin family

Database Links

KEGG: mmu:19662

STRING: 10090.ENSMUSP00000025951

UniGene: Mm.2605

Code	CSB-MP4018MO
Abbreviation	Recombinant Mouse Rbp4 protein (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr (CSB-MP025270MO) at 5 μg/ml can bind Mouse Rbp4, the EC₅₀ is 38.07-75.83 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Retinol-binding protein 4 (Rbp4) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage