Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr (CSB-MP025270MO) at 5 μg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL.
Alternative Names
(Plasma retinol-binding protein)(PRBP)(RBP)
Molecular Characterization
Species
Mus musculus (Mouse)
Expression Region
19-201aa
Target Protein Sequence
ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Mouse Rbp4 recombinant protein was produced in mammalian cell, where the gene sequence encoding mouse Rbp4 (19-201aa.) was expressed with the C-terminal hFc tag. The purity of this Rbp4 protein was was greater than 90% by SDS-PAGE. Its activity was measured by its binding ability in a functional ELISA.
Retinol Binding Protein 4 (RBP4) is the carrier of retinol in the blood. It belongs to the lipocalin family and contains a 21 kD protein with a retinol binding site. RBP4 is the most important extracellular transporter, responsible for binding and transporting retinol in the blood. Adipose, kidney, testis, brain and digestive tract tissues can all synthesize and secrete RBP4. But under normal physiological conditions the main source of this protein is the liver. Many studies have found that RBP4 plays an important role in obesity, insulin resistance, metabolic syndrome, hypertension and atherosclerosis, and is expected to provide important clues for the pathogenesis and therapeutic targets of related diseases.
