Recombinant Mouse Retinol-binding protein 4 (Rbp4) (Active)

In Stock Promotion
Code CSB-MP4018MO
Abbreviation Recombinant Mouse Rbp4 protein (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr (CSB-MP025270MO) at 5 μg/ml can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr (CSB-MP025270MO) at 5 μg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL.
Target Names
Uniprot No.
Alternative Names
(Plasma retinol-binding protein)(PRBP)(RBP)
Molecular Characterization
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
19-201aa
Target Protein Sequence
ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL
Mol. Weight
50.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Retinol-binding protein 4 serves as the principal carrier of retinol in plasma and signals through interactions with transthyretin (Ttr) to prevent renal filtration, making its binding competence a critical functional benchmark. This recombinant mouse Rbp4 (residues 19–201, full-length mature protein) demonstrates confirmed Ttr-binding activity with an EC50 of 38.07–75.83 ng/mL in functional ELISA, verifying the conformational integrity required for ligand-binding and cargo-release assays, drug-protein interaction studies, and use as a quantitative ELISA standard. Expressed in mammalian cells with a C-terminal hFc1 tag, the protein supports antibody development campaigns and structural or biophysical characterization where native-like folding is essential. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based membrane transporter functional assays and cancer biology research involving retinoid signaling pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.
Gene References into Functions
  1. RBP4 is involved in all-trans retinoic acid-induced cleft palate. PMID: 28849085
  2. RBP4-induced inflammation is largely mediated by TLR4. PMID: 28400700
  3. New insights into ghrelin cell physiology, and given the known functions of RBP4 and TTR, support an emerging role for the ghrelin cell in blood glucose handling and metabolism. PMID: 23840311
  4. Retinal degeneration in RBP4-Tg mice is RBP4-dependent and light-independent. PMID: 28813718
  5. Rbp4-deficient mice accumulated retinol in the liver but it was undetectable in the serum, indicating an inverse relation between serum and liver retinol levels. RBP4 is critical for the mobilization of retinol from hepatic storage pools, and such mobilization is necessary for ocular development and visual function. PMID: 26974396
  6. Hepatocytes Are the Principal Source of Circulating RBP4 in Mice PMID: 27797907
  7. RBP4 may be a critical modulator promoting the vicious cycle of insulin resistance and heart failure by activating TLR4/MyD88-mediated inflammatory pathways. Potentially, lowering RBP4 might break the vicious cycle and improve both insulin resistance and cardiac hypertrophy. PMID: 27100622
  8. Data (including data from studies in knockout mice) suggest that Rbp4 (plasma retinol-binding protein 4) is critical for antigen presentation and activation of CD4-positive T-lymphocyte in development of insulin resistance in mice obese due to high-fat diet. PMID: 26936962
  9. A novel mechanism for circadian regulation of RBP4, but also a critical role of RBP4, acting as a hepatokine in the regulation of glucose metabolism by the circadian clock. PMID: 26564180
  10. Elevated serum RBP4 raises BP. PMID: 25911613
  11. These data show that decreasing circulating TTR levels or altering TTR-RBP4 binding could be a potential therapeutic approach for the treatment of type 2 diabetes. PMID: 25524914
  12. findings suggest that RBP4 impaired in vivo adipogenesis, partly through the repression of the insulin pathway PMID: 24590924
  13. The data implicate the involvement of chondrocytic Rbp4 in bone growth, particularly in the formation of the secondary ossification center of the limb. PMID: 23224267
  14. STRA6 in tissues other than the eye appears to be the coupling of circulating holo-RBP levels to cell signaling, in turn regulating key processes such as insulin response. PMID: 23839944
  15. expression of RBPR2 in liver and fat suggests a possible role in mediating established metabolic actions of RBP4 in those tissues PMID: 23105095
  16. TTR blocks the ability of holo-retinol-binding protein to associate with STRA6 and thereby effectively suppresses both STRA6-mediated retinol uptake and STRA6-initiated cell signaling. PMID: 22826435
  17. Suggest that RBP4 may be involved in the dyslipidemia associated with polycystic ovary syndrome in nonobese adolescents and that there may be an independent relationship between RBP4 and triglycerides but not between RBP4 and insulin resistance. PMID: 22341881
  18. RBP4 is not only an adipocytokine, but also a hepatic cytokine leading to metabolic syndrome, non-alcoholic fatty liver disease and type 2 diabetes. PMID: 21983273
  19. results indicate that rimonabant may improve vascular function by modulating RBP4 along with pro-inflammatory cytokines PMID: 21585349
  20. Basal and cyclic AMP-induced Rbp4 transcription is regulated by a multiprotein complex that is similar to ones that modulate expression of genes of steroid hormone biosynthesis. PMID: 19389484
  21. RBP4 is an adipocyte-derived 'signal' that may contribute to the pathogenesis of type 2 diabetes PMID: 16034410
  22. Lowering transthyretin(TTR) levels or interfering with RBP4-TTR binding may enhance insulin sensitivity in obesity and type 2 diabetes PMID: 18285525
  23. These results reveal a selective effect of all-trans retinoic acid inhibiting RBP4 expression specifically in adipocytes. PMID: 18769064
  24. Identification and characterization of a non-retinoid ligand for retinol-binding protein 4 which lowers serum retinol-binding protein 4 levels in vivo. PMID: 19147488
  25. HMGA1 is an important modulator of RBP4 gene expression in vivo. PMID: 19460132
  26. Although mice lacking HMGA1 are diabetic and express very low levels of the insulin receptor, they have increased insulin sensitivity. Changes in circulating Rbp4 might partly account for this paradox. [REVIEW] PMID: 19664187

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*