Recombinant Nipah virus Glycoprotein G (G), partial (Active)

In Stock
Code CSB-MP862323NDT1
Abbreviation Recombinant Nipah virus G protein,partial (Active)
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Nipah virus G at 2 μg/ml can bind Human EFNB2 (CSB-MP007466HU1). The EC50 is 0.6010-0.7267 ng/mL. Biological Activity Assay
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Nipah virus G at 2 μg/ml can bind Anti-G recombinant antibody (CSB-RA862323MA1NDT). The EC50 is 0.9580-1.101 ng/mL. Biological Activity Assay
  • Activity
    Human EFNB2 (CSB-MP007466HU1) captured on Protein A Chip can bind Recombinant Nipah virus G with an affinity constant of 0.358 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
  • Activity
    G Recombinant Monoclonal Antibody (CSB-RA862323MA1NDT) captured on Protein A Chip can bind Recombinant Nipah virus G with an affinity constant of 0.399 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Nipah virus G at 2 μg/mL can bind Human EFNB2 (CSB-MP007466HU1). The EC50 is 0.6010-0.7267 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Nipah virus G at 2 μg/mL can bind Anti-G recombinant antibody (CSB-RA862323MA1NDT). The EC50 is 0.9580-1.101 ng/mL.
③Human EFNB2 (CSB-MP007466HU1) captured on Protein A Chip can bind Recombinant Nipah virus G with an affinity constant of 0.358 nM as detected by MetaSPR Assay (WeSPRTM 200).
④G Recombinant Monoclonal Antibody (CSB-RA862323MA1NDT) captured on Protein A Chip can bind Recombinant Nipah virus G with an affinity constant of 0.399 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
G
Uniprot No.
Alternative Names
Glycoprotein G
Species
Nipah virus
Source
Mammalian cell
Expression Region
71-602aa
Target Protein Sequence
QNYTRSTDNQAVIKDALQGIQQQIKGLADKIGTEIGPKVSLIDTSSTITIPANIGLLGSKISQSTASINENVNEKCKFTLPPLKIHECNISCPNPLPFREYRPQTEGVSNLVGLPNNICLQKTSNQILKPKLISYTLPVVGQSGTCITDPLLAMDEGYFAYSHLERIGSCSRGVSKQRIIGVGEVLDRGDEVPSLFMTNVWTPPNPNTVYHCSAVYNNEFYYVLCAVSTVGDPILNSTYWSGSLMMTRLAVKPKSNGGGYNQHQLALRSIEKGRYDKVMPYGPSGIKQGDTLYFPAVGFLVRTEFKYNDSNCPITKCQYSKPENCRLSMGIRPNSHYILRSGLLKYNLSDGENPKVVFIEISDQRLSIGSPSKIYDSLGQPVFYQASFSWDTMIKFGDVLTVNPLVVNWRNNTVISRPGQSQCPRFNTCPEICWEGVYNDAFLIDRINWISAGVFLDSNQTAENPVFTVFKDNEILYRAQLASEDTNAQKTITNCFLLKNKIWCISLVEIYDTGDNVIRPKLFAVKIPEQCT
Mol. Weight
60.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Interacts with host ephrinB2/EFNB2 or ephrin B3/EFNB3 to provide virion attachment to target cell. This attachment induces virion internalization predominantly through clathrin-mediated endocytosis.
Gene References into Functions
  1. G and the fusion protein F are both crucial glycoproteins located on the surface of the virus envelope. [review] PMID: 29963835
  2. the binding of the viral attachment protein G to its host receptor ephrinB2 was studied and showed monomeric and dimeric receptors activate distinct conformational changes in G. PMID: 28974687
  3. Data suggest that fusion of Nipah viruses with host cells is facilitated by two of viral membrane proteins, the G protein and the F protein; G head domain binds to human ephrins B2 and B3 altering conformational density of entire G head domain. PMID: 24615845
  4. Authors identified a G stalk C-terminal region (amino acids 159 to 163) that is important for multiple G functions, including G tetramerization, conformational integrity, G-F interactions, receptor-induced conformational changes in G, and F triggering. PMID: 25428863
  5. Cysteine cluster in the G protein is involved in stabilizing a unique microdomain critical for triggering fusion. PMID: 22496210
  6. Results indicated that the G-H loop of ephrin-B2 was indeed critical for the interaction between ephrin-B2 and Nipah virus-G. PMID: 21632558
  7. the G protein appeared to be constitutively internalized with the bulk flow during membrane turnover PMID: 15731282
  8. sNiV-G binds to ephrinB3 with a 30-fold higher affinity than that of sHeV-G. PMID: 17652392
  9. report the crystal structures of the NiV-G both in its receptor-unbound state and in complex with ephrin-B3, providing, to our knowledge, the first view of a paramyxovirus attachment complex in which a cellular protein is used as the virus receptor PMID: 18632560

Show More

Hide All

Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.
Protein Families
Paramyxoviruses hemagglutinin-neuraminidase family
Database Links

KEGG: vg:920955

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*