Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12(rplL)

In Stock
Code CSB-EP730328SMZ
Product Type Recombinant Protein
Size US$2062Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q5XCB4
Abbreviation rplL
Relevance Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP730328SMZ could indicate that this peptide derived from E.coli-expressed Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) rplL.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP730328SMZ could indicate that this peptide derived from E.coli-expressed Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) rplL.
Storage Buffer Tris-based buffer,50% glycerol
Species Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEAAKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVAAAEAEEIKAKLEEAGATITLK
Research Area others
Source E.coli
Gene Names rplL
Protein Names Recommended name: 50S ribosomal protein L7/L12
Expression Region 1-121aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 32.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.
Protein Families Bacterial ribosomal protein bL12 family
Database Links

KEGG: spa:M6_Spy0814

Related Products

rplL Antibodies

rplL Antibodies for Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)

rplL Proteins

rplL Proteins for Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.