Home
Protein
Recombinant Proteins
Recombinant Shigella flexneri Adenylate kinase (adk)

Recombinant Shigella flexneri Adenylate kinase (adk)

^{In Stock}

Code	CSB-EP769467SZB
Abbreviation	Recombinant Shigella flexneri adk protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

adk

Uniprot No.

Q83M40

Research Area

Signal Transduction

Alternative Names

adk; SF0419; S0426; Adenylate kinase; AK; EC 2.7.4.3; ATP-AMP transphosphorylase; ATP:AMP phosphotransferase; Adenylate monophosphate kinase

Species

Shigella flexneri

Source

E.coli

Expression Region

1-214aa

Target Protein Sequence

MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

43.6kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Explore the functionality of Shigella flexneri Adenylate Kinase with the Recombinant Shigella flexneri adk protein. This full-length protein, comprising the 1-214aa region, is expressed in E. coli and exhibits a unique dual-tagging system: an N-terminal 10xHis-SUMO-tag for straightforward purification, and a C-terminal Myc-tag for convenient detection. With a purity level exceeding 90% as determined by SDS-PAGE, this lyophilized powder enables researchers to delve into the role of Adenylate Kinase in signal transduction and expand our understanding of this bacterial enzyme's potential applications.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.

Subcellular Location

Cytoplasm.

Protein Families

Adenylate kinase family

Database Links

KEGG: sfl:SF0419

Promotions