Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A

Code CSB-EP365519SQB
Product Type Recombinant Protein
Size US$2466
Uniprot No. P01092
Relevance Inhibits mammalian alpha-amylases specifically but has no action on plant and microbial alpha-amylases. Forms a tight stoichiometric 1:1 complex with alpha-amylase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365519SQB could indicate that this peptide derived from E.coli-expressed Streptomyces tendae N/A.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365519SQB could indicate that this peptide derived from E.coli-expressed Streptomyces tendae N/A.
Storage Buffer Tris-based buffer,50% glycerol
Species Streptomyces tendae
Purity Greater than 85% as determined by SDS-PAGE.
Sequence DTTVSEPAPSCVTLYQSWRYSQADNGCAQTVTVKVVYEDDTEGLCYAVAPGQITTVGDGYIGSHGHARYLARCL
Research Area others
Source E.coli
Protein Names Tendamistat
Expression Region 31-104aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 28.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits mammalian alpha-amylases specifically but has no action on plant and microbial alpha-amylases. Forms a tight stoichiometric 1

Related Products

Antibodies

Antibodies for Streptomyces tendae

Proteins

Proteins for Streptomyces tendae

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.