Home
Protein
Recombinant Proteins
Recombinant Aspergillus niger Aspergillopepsin-2，partial

Recombinant Aspergillus niger Aspergillopepsin-2，partial

^{In Stock}

Code	CSB-EP338616DOZ
Abbreviation	Recombinant Aspergillus niger Aspergillopepsin-2 protein, partial
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Uniprot No.

P24665

Research Area

Microbiology

Alternative Names

Aspergillopepsin-2; EC 3.4.23.19; Acid protease A; Aspergillopepsin II; Proctase A) [Cleaved into: Aspergillopepsin-2 light chain; Aspergillopepsin II light chain); Aspergillopepsin-2 heavy chain; Aspergillopepsin II heavy chain)]

Species

Aspergillus niger

Source

E.coli

Expression Region

60-98aa

Target Protein Sequence

EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.9kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Enhance your microbiology research with our recombinant Aspergillus niger Aspergillopepsin-2 protein, a partial protein covering the 60-98aa expression region. Aspergillopepsin-2 is an essential proteolytic enzyme with applications in both scientific and industrial settings. Produced in E.coli, this protein features an N-terminal 6xHis-SUMO tag for efficient purification and displays a purity greater than 90% as determined by SDS-PAGE. Supplied as a lyophilized powder, Aspergillopepsin-2 ensures ease of use and stability for your microbiology investigations.