Recombinant Onchocerca volvulus OV-16 antigen (OV16)

In Stock
Code CSB-EP341251OEG
Abbreviation Recombinant Onchocerca volvulus OV16 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
OV16
Uniprot No.
Research Area
Others
Alternative Names
OV16; OV-16 antigen
Species
Onchocerca volvulus
Source
E.coli
Expression Region
17-197aa
Target Protein Sequence
KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Onchocerca volvulus OV16 contains amino acids 17-197. The expected molecular weight for the OV16 protein is calculated to be 24 kDa. This OV16 protein is produced using e.coli expression system. The N-terminal 6xHis tag was smoothly integrated into the coding gene of OV16, which enables a simple process of detecting and purifying the OV16 recombinant protein in the following steps.

The OV-16 antigen is specific to O. volvulus and is not found in other filarial nematodes. OV-16 is used in serological tests to detect antibodies produced by the human immune system in response to O. volvulus infection. Serological tests, such as enzyme-linked immunosorbent assays (ELISAs), based on the detection of antibodies against OV-16, are valuable tools for epidemiological studies and for monitoring the success of onchocerciasis control programs, particularly mass drug administration campaigns.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 2 reviews

Submit a Review here

Applications : Cell culture

Review: Maxisorp Plates were incubated Linear epitopes in Onchocerca volvulus overnight at 4˚C with 100 μL of Recombinant Ov-16 antigen for Onchocerca volvulus at 1 μg/ml.

By Anonymous

Applications : ELISA standard and its raw materials

Review: ELISA measurements of the antibody responses to OvMP-1 (IgG), OvMP-23 (IgG) and Ov16 (IgG4) in sera from study participants from Jimma Town (Ethiopia). Participants are grouped according to the type of helminth infection that was detected by coprological examination. The dashed lines indicate the antigen-specific cut-offs: 0.045 for OvMP-1; 0.11 for OvMP-23 and 0.10 for Ov16.

By Anonymous

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*