Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA)

In Stock
Code CSB-EP357202AWW
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P07773
Lead Time 3-7 business days
Relevance Catechol + O2 = cis,cis-muconate.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 1,2-CTD
Species Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV
Research Area Microbiology
Source E.coli
Gene Names catA
Protein Names Recommended name: Catechol 1,2-dioxygenase EC= 1.13.11.1 Alternative name(s): 1,2-CTD
Expression Region 1-311aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 50.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

catA Antibodies

catA Antibodies for Acinetobacter baylyi

catA Proteins

catA Proteins for Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.