Recombinant Alternaria alternata Major allergen Alt a 1 (ALTA1)

In Stock
Code CSB-EP303588AZV
Abbreviation Recombinant Alternaria alternata ALTA1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ALTA1
Uniprot No.
Research Area
Others
Alternative Names
ALTA1; Major allergen Alt a 1; allergen Alt a 1
Species
Alternaria alternata (Alternaria rot fungus) (Torula alternata)
Source
E.coli
Expression Region
19-157aa
Target Protein Sequence
APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The protein AltA1, also known as ALTA1, is a member of the AltA1 family, a group of structural proteins found in fungi [1]. AltA1 has been identified in various fungal species, including Ascochyta lentis, Botrytis cinerea, Fusarium oxysporum f. sp. vasinfectum, and Venturia inaequalis [2][3][4]. AltA1 has been implicated as a major allergen in Alternaria species [2]. Additionally, AltA1 has been identified as an effector protein in *Venturia inaequalis*, the causal agent of apple scab, with a significant increase in expression [4]. Furthermore, AltA1 has been associated with the pathophysiology of fungal plant pathogens and is believed to play a role in the secretion of extracellular vesicles [3].

The AltA1 family, to which the protein AltA1 belongs, has been characterized as a group of non-canonical pathogen-associated molecular pattern (PAMP) proteins, suggesting a potential role in the hypersensitive response in plants [1]. Moreover, a study on fungal orphan candidate effectors revealed that AltA1, along with other families of proteins, displayed a decrease in frustration index with residue surface exposure, indicating a potential structural landscape and evolvability of these proteins [5].

References:
[1] J. T, T. Leisen, S. Ce, J. Müller, F. Mahler, F. Sommeret al., "The secreted hypersensitive response inducing protein 1 frombotrytis cinereadisplays non-canonical pamp-activity",, 2020. https://doi.org/10.1101/2020.12.16.423131
[2] R. Lee, L. Farfan-Caceres, J. Debler, A. Williams, R. Syme, & B. Henares, "Reference genome assembly for australianascochyta lentisisolate al4", G3 Genes|genome|genetics, vol. 11, no. 2, 2021. https://doi.org/10.1093/g3journal/jkab006
[3] D. Garcia-Ceron, C. Dawson, P. Faou, M. Bleackley, & M. Anderson, "Size‐exclusion chromatography allows the isolation of evs from the filamentous fungal plant pathogen fusarium oxysporum f. sp. vasinfectum (fov)", Proteomics, vol. 21, no. 13-14, 2021. https://doi.org/10.1002/pmic.202000240
[4] Y. Khajuria, B. Akhoon, S. Kaul, & M. Dhar, "Secretomic insights into the pathophysiology of venturia inaequalis: the causative agent of scab, a devastating apple tree disease", Pathogens, vol. 12, no. 1, p. 66, 2022. https://doi.org/10.3390/pathogens12010066
[5] M. Derbyshire and S. Raffaele, "Surface frustration re-patterning underlies the structural landscape and evolvability of fungal orphan candidate effectors",, 2023. https://doi.org/10.1101/2023.01.06.522876

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I am looking for the antibody against the protein CSB-EP303588AZV. Do you have it commercially avaiable? I need small amount for WB.

A:

We can provide you with the protein CSB-EP303588AZV for corresponding WB verification. Or we can provide you with a free trial of CSB-PA303588LA01AZV 20ug for WB verification of protein CSB-EP303588AZV.

Target Background

Subcellular Location
Secreted.
Protein Families
ALTA1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*