Recombinant Apis mellifera Phospholipase A2

In Stock
Code CSB-EP018091DNK
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Phospholipase A2; bvPLA2; EC 3.1.1.4; Allergen Api m I; Phosphatidylcholine 2-acylhydrolase; allergen Api m 1
Species
Apis mellifera (Honeybee)
Source
E.coli
Expression Region
34-167aa
Target Protein Sequence
IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
19.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Apis mellifera Phospholipase A2 was produced in E.coli, where the gene sequence encoding Apis mellifera Phospholipase A2 (34-167aa) was expressed with the N-terminal 6xHis tag. The purity of this Phospholipase A2 was greater than 85% by SDS-PAGE.
Phospholipase A2, abbreviated as PLA2, is a class of enzymes with its primary function being the hydrolysis of phospholipids, a major type of lipid present in cell membranes, to produce free fatty acids and soluble phospholipids. This process plays a crucial role in the metabolism of cell membranes, cell signal transduction, and inflammatory responses.
PLA2 also plays a role in the defense mechanisms of bees. Bee stings contain venom that includes proteins like PLA2, which are used to defend against predators. These proteins may cause the cell membranes of adversaries to rupture, leading to pain and an inflammatory response.
Proteins like PLA2 are also of significant value in medical research because they are associated with inflammatory conditions, neurological disorders, and other diseases. Some drugs and treatment approaches target PLA2 enzymes in the search for ways to treat inflammatory diseases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
Gene References into Functions
  1. PLA(2)s were located on the membrane surface rather than penetrating the membrane bilayer and that the deeply inserted mode is not a favorable condition for the hydrolysis of phospholipids in zwitterionic phospholipid membranes. PMID: 21557547
  2. contributions of the individual disulfide bonds to conformational stability PMID: 20884319
  3. successive introduction of sequence modifications outside the human and murine T cell epitope regions led to a progressive loss of specific IgE and IgG reactivity PMID: 15459335
  4. Studies with bee venom (bv) mutant PLA2 show that electrostatic interactions between lysine and arginine residues and anionic phosphatidylserine contribute minimally to overall interfacial binding energetics of bvPLA2. PMID: 15491136
Subcellular Location
Secreted.
Protein Families
Phospholipase A2 family, Group III subfamily
Tissue Specificity
Expressed by the venom gland.
Database Links

KEGG: ame:406141

STRING: 7460.GB13351-PA

UniGene: Ame.2

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*