Recombinant Ascaris suum Major pepsin inhibitor 3(PI-3)

Product Type Recombinant Protein
Uniprot No. P19400
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Alias Short name:PI-3
Species Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
Research Area Others
Protein Names Recommended name: Major pepsin inhibitor 3 Short name= PI-3
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function This is an inhibitor of the aspartic protease pepsin.
Subcellular Location Secreted
Protein Families Protease inhibitor I33 family
Tissue Specificity Body wall.

Product Details for Different Expression Systems

Product Name Recombinant Ascaris suum Major pepsin inhibitor 3(PI-3),Yeast
Code CSB-YP322527DOS
Size Pls inquiry other sizes
Source Yeast
Purity Greater than 90% as determined by SDS-PAGE.
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ
Expression Region 21-169aa
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Ascaris suum Major pepsin inhibitor 3(PI-3),Baculovirus
Code CSB-BP322527DOS
Size Pls inquiry other sizes
Source Baculovirus
Purity Greater than 90% as determined by SDS-PAGE.
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ
Expression Region 21-169aa
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Ascaris suum Major pepsin inhibitor 3(PI-3),Mammalian cell
Code CSB-MP322527DOS
Size Pls inquiry other sizes
Source Mammalian cell
Purity Greater than 90% as determined by SDS-PAGE.
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ
Expression Region 21-169aa
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.