Recombinant Atlantic salmon Vertebrate ancient opsin,Partial

In Stock
Code CSB-EP517517SWI
Abbreviation Recombinant Atlantic salmon Vertebrate ancient opsin protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
others
Alternative Names
Vertebrate ancient opsin
Species
Salmo salar (Atlantic salmon)
Source
E.coli
Expression Region
1-75aa
Target Protein Sequence
MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Atlantic salmon Vertebrate ancient opsin is expressed in E. coli and features an N-terminal 6xHis-B2M tag. This partial protein spans amino acids 1-75. Purification appears to reach levels exceeding 90%, as confirmed by SDS-PAGE analysis. The protein seems suitable for research applications and shows no detectable endotoxin levels.

Vertebrate ancient opsin is a light-sensitive protein that may be involved in non-visual photoreception. It likely plays a role in regulating circadian rhythms and other physiological processes influenced by light. This protein has drawn considerable interest from researchers trying to understand how light perception mechanisms evolved across different vertebrate species.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Atlantic salmon vertebrate ancient opsin is a transmembrane GPCR that requires precise folding, proper membrane integration, chromophore (retinal) binding, and specific seven-transmembrane helix formation for its phototransduction activity. The E. coli expression system cannot provide the necessary membrane environment for this complex transmembrane protein. The partial fragment (1-75aa) represents only a small N-terminal portion of the full-length opsin (typically 350-400aa) and lacks the critical transmembrane domains and chromophore-binding sites. The large N-terminal 6xHis-B2M tag (∼12 kDa) is significantly larger than the opsin fragment itself (∼8 kDa) and will completely dominate the protein's properties. This construct cannot form any functional opsin structure or exhibit phototransduction activity.

1. Antibody Development and Validation

This application has limited utility. While antibodies can be generated against this specific 75aa N-terminal fragment, they will not recognize conformational epitopes of the full-length transmembrane opsin and may not bind the native protein in physiological contexts. The immune response will primarily target the dominant B2M tag rather than the small opsin fragment.

2. Structural and Biochemical Characterization Studies

Basic biophysical analysis can be performed, but will primarily reflect the B2M tag's properties rather than opsin structure. The 75aa fragment is too short and incomplete to provide meaningful insights into opsin biochemistry or evolution. Results will describe a misfolded tag-fusion protein rather than native opsin characteristics.

3. Tag-Based Detection Assay Development

This application is feasible but has limited research value. Assays can be developed targeting the His-B2M tags, but these will detect the tag fusion protein rather than providing insights into opsin biology. Such assays would be useful only for tracking this specific recombinant protein preparation.

Final Recommendation & Action Plan

This construct is fundamentally unsuitable for opsin research. The 75aa fragment represents only ~20% of the full-length opsin and lacks all critical functional domains (transmembrane helices, chromophore-binding site). The large B2M tag dominates the protein's properties, making any data biologically irrelevant to opsin function. The only limited applications are tag-specific detection and generating antibodies against this specific fragment. For authentic opsin research, use a full-length protein expressed in mammalian systems with proper membrane integration and chromophore binding capability.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 2 reviews

Submit a Review here

Applications : Drug related studies

Review: Recombinant vertebrate ancient opsin was dissolved in 0.9% physiological saline, and each fish was injected with VAL-opsin [0.1 and 0.5 μg/g, body mass (BM)] at a volume of 10 μL/g BM.

By Anonymous

Applications : Drug treatment

Review: Changes in vertebrate ancient long opsin (VAL-opsin) mRNA expression levels upon light treatment (green LED(520 nm) (G) and a white fluorescent bulb (W)) in the hypothalamus after VAL-opsin (0.5 μg/g BM), cetrorelix (Cx) (0.5 μg/fish), or cetrorelix (Cx) (0.5 μg/fish) + VAL-opsin (0.5 μg/g BM) injections, and no injection as a control group (Cont.). Different letters indicate significant differences between groups with respect to simultaneous VAL-opsin injection (P < 0.05).

By Anonymous

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Database Links

KEGG: sasa:100136521

UniGene: Ssa.192

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*