Recombinant Atlantic salmon Vertebrate ancient opsin,Partial

In Stock
Code CSB-EP517517SWI
Abbreviation Recombinant Atlantic salmon Vertebrate ancient opsin protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
others
Alternative Names
Vertebrate ancient opsin
Species
Salmo salar (Atlantic salmon)
Source
E.coli
Expression Region
1-75aa
Target Protein Sequence
MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Atlantic salmon Vertebrate ancient opsin is expressed in E. coli and features an N-terminal 6xHis-B2M tag. This partial protein spans amino acids 1-75. Purification appears to reach levels exceeding 90%, as confirmed by SDS-PAGE analysis. The protein seems suitable for research applications and shows no detectable endotoxin levels.

Vertebrate ancient opsin is a light-sensitive protein that may be involved in non-visual photoreception. It likely plays a role in regulating circadian rhythms and other physiological processes influenced by light. This protein has drawn considerable interest from researchers trying to understand how light perception mechanisms evolved across different vertebrate species.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-B2M tag allows for purification and immobilization of this recombinant Atlantic salmon vertebrate ancient opsin fragment on nickel-affinity resins. Scientists can potentially use this tagged protein as bait to fish out binding partners from salmon tissue lysates or other protein libraries. The partial sequence (1-75aa) might contain key interaction domains that could reveal binding motifs conserved through evolution. This strategy may help researchers piece together the molecular networks involving ancient opsins in early vertebrate vision systems.

2. Antibody Development and Validation

This purified recombinant protein fragment appears suitable as an immunogen for creating polyclonal or monoclonal antibodies specific to Atlantic salmon vertebrate ancient opsin. The high purity (>90%) should minimize cross-reactivity with contaminating proteins during immunization. Scientists can then use the same recombinant protein to test antibody specificity through ELISA, Western blot, or surface plasmon resonance assays. These antibodies would likely prove valuable for studying opsin expression patterns and localization in salmon tissues.

3. Structural and Biochemical Characterization Studies

Various biophysical analyses could be performed on this recombinant protein fragment to understand the structural properties of this ancient opsin domain. Circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation may provide insights into secondary structure, oligomerization state, and stability. The 6xHis-B2M tag makes consistent purification possible, which should help with reproducible structural studies across different experimental conditions.

4. Evolutionary and Comparative Protein Analysis

This Atlantic salmon ancient opsin fragment may serve as a useful reference for comparative studies with opsins from other vertebrate species. Scientists can perform sequence alignment, phylogenetic analysis, and cross-species binding studies to understand evolutionary relationships. The recombinant protein might be useful in competitive binding assays or cross-reactivity studies with antibodies or binding partners from related species to map conserved functional domains.

5. Tag-Based Detection Assay Development

The N-terminal 6xHis-B2M tag system opens up possibilities for developing sandwich-type detection assays using anti-His or anti-B2M antibodies. Scientists can establish quantitative assays for measuring protein concentration, stability, or degradation kinetics under various experimental conditions. This tagged protein could also work as a positive control or standard in assays designed to study opsin-related proteins in salmon research.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 2 reviews

Submit a Review here

Applications : Drug related studies

Review: Recombinant vertebrate ancient opsin was dissolved in 0.9% physiological saline, and each fish was injected with VAL-opsin [0.1 and 0.5 μg/g, body mass (BM)] at a volume of 10 μL/g BM.

By Anonymous

Applications : Drug treatment

Review: Changes in vertebrate ancient long opsin (VAL-opsin) mRNA expression levels upon light treatment (green LED(520 nm) (G) and a white fluorescent bulb (W)) in the hypothalamus after VAL-opsin (0.5 μg/g BM), cetrorelix (Cx) (0.5 μg/fish), or cetrorelix (Cx) (0.5 μg/fish) + VAL-opsin (0.5 μg/g BM) injections, and no injection as a control group (Cont.). Different letters indicate significant differences between groups with respect to simultaneous VAL-opsin injection (P < 0.05).

By Anonymous

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Database Links

KEGG: sasa:100136521

UniGene: Ssa.192

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*