Recombinant Bacillus licheniformis Subtilisin Carlsberg (subC)

In Stock
Code CSB-EP365470BQT
Abbreviation Recombinant Bacillus licheniformis apr protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365470BQT could indicate that this peptide derived from E.coli-expressed Bacillus licheniformis apr.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365470BQT could indicate that this peptide derived from E.coli-expressed Bacillus licheniformis apr.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
apr
Uniprot No.
Research Area
others
Alternative Names
subC; apr; Subtilisin Carlsberg; EC 3.4.21.62
Species
Bacillus licheniformis
Source
E.coli
Expression Region
106-379aa
Target Protein Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bacillus licheniformis apr is an E.coli cell-expressed protein (Full Length of Mature Protein). E.coli expression systems are popular because bacteria are easy to culture, grow fast and produce high yields of recombinant protein. Traditional strategies for Bacillus licheniformis apr recombinant protein expression involve transforming the recombinant plasmid into the E. coli host. The cells were directly replicated, transcribed and translated, and IPTG was added to express the desired protein. Typically, the cells are then lysed to extract the expressed protein for subsequent purification. Also, many proteins become insoluble as inclusion bodies that are very difficult to recover, so mild conditions and subsequent cumbersome protein-refolding procedures are used to ensure the final provided protein is soluble.

apr (also known as subC) is a gene providing an instruction in making a protein named subtilisin carlsberg in Bacillus licheniformis. The protein encoded by this gene belongs to peptidase S8 family, a group of serine proteases that – like all serine proteases – initiate the nucleophilic attack on the peptide bond through a serine residue at the active site. The gene from Bacillus licheniformis has been isolated by molecular cloning using a mixture of synthetic oligonucleotides. The entire nucleotide sequence of the coding sequence as well as 5′ and 3′ flanking sequences have been determined.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides (Ref.4, PubMed:11109488). Shows high specificity for aromatic and hydrophobic amino acids in the P1 substrate position. May play an important role in the degradation of feather keratin.
Subcellular Location
Secreted.
Protein Families
Peptidase S8 family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*