Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr)


In Stock
Code CSB-EP365470BQT
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P00780
Relevance Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365470BQT could indicate that this peptide derived from E.coli-expressed Bacillus licheniformis apr.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365470BQT could indicate that this peptide derived from E.coli-expressed Bacillus licheniformis apr.
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus licheniformis
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Research Area others
Source E.coli
Gene Names apr
Protein Names Recommended name: Subtilisin Carlsberg EC= 3.4.21.62
Expression Region 106-379aa
Tag Info N-terminal 10xHis-SUMO-tagged
Mol. Weight 45.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
Subcellular Location Secreted
Protein Families Peptidase S8 family

Related Products

apr Antibodies

apr Antibodies for Bacillus licheniformis

apr Proteins

apr Proteins for Bacillus licheniformis

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.