Home
Protein
Recombinant Proteins
Recombinant Bacillus thuringiensis subsp. Kurstaki Pesticidal crystal protein cry1Ia (cry1Ia), partial

Recombinant Bacillus thuringiensis subsp. Kurstaki Pesticidal crystal protein cry1Ia (cry1Ia), partial

^{In Stock}

Code	CSB-EP673817BDC
Abbreviation	Recombinant Bacillus thuringiensis subsp. Kurstaki cry1Ia protein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

cry1Ia

Uniprot No.

Q45752

Research Area

others

Alternative Names

81 kDa crystal protein;Crystaline entomocidal protoxin;Insecticidal delta-endotoxin CryII(a)

Species

Bacillus thuringiensis subsp. Kurstaki

Source

E.coli

Expression Region

97-180aa

Target Protein Sequence

GKNQWEIFMEHVEEIINQKISTYARNKALTDLKGLGDALAVYHDSLESWVGNRNNTRARSVVKSQYIALELMFVQKLPSFAVSG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.9 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-KSI-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The process for producing recombinant Bacillus thuringiensis subsp. Kurstaki cry1Ia protein in e.coli cells follows a sequence of steps: creating the expression vector that codes for the Bacillus thuringiensis subsp. Kurstaki cry1Ia protein (97-180aa), introducing it into e.coli cells, cultivating and inducing of positive cells for protein expression, lysing cells, and conducting expression analysis. The resultant recombinant Bacillus thuringiensis subsp. Kurstaki cry1Ia protein is purified from the cell lysate using affinity purification, with its purity exceeding 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori.

Protein Families

Delta endotoxin family

Promotions