Home
Protein
Recombinant Proteins
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial

^{In Stock}

Code	CSB-EP363358BDC
Abbreviation	Recombinant Bacillus thuringiensis subsp. kurstaki cry1Ab protein, partial
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

cry1Ab

Uniprot No.

P0A370

Research Area

Others

Alternative Names

cry1Ab; bt2; cry-1-2; cry1A(b); cryIA(b); cryIC1Pesticidal crystal protein Cry1Ab; 130 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryIA(b)

Species

Bacillus thuringiensis subsp. kurstaki

Source

E.coli

Expression Region

1022-1155aa

Target Protein Sequence

HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.3kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Enhance your insecticidal research with our recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal Crystal Protein Cry1Ab. This powerful, partial-length protein spans the 1022-1155aa expression region and is produced in E.coli to ensure efficient expression and authentic representation. The N-terminal 6xHis-SUMO tag enables straightforward purification while maintaining the protein's integrity. With a purity greater than 90% as determined by SDS-PAGE, this lyophilized powder format Cry1Ab protein is ideal for various research applications and an essential tool for your pesticidal protein investigations.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I would like to confirm whether or not I can reconstitute this in water? More specifically DMEM/F12 assay media at a neutral pH, low endo-toxin? Is this product suitable?

Our technical team speculated that you may be applying protein to cell culture. Is it right?
The above protein is expressed in supernatant. We can prepare according to PBS, buffer, aseptic processing and endotoxin removal, but there is no guarantee that the protein will be active.