Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA)

In Stock
Code CSB-EP356423BUA
Abbreviation Recombinant Bordetella pertussis ptxA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356423BUA could indicate that this peptide derived from E.coli-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) ptxA.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356423BUA could indicate that this peptide derived from E.coli-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) ptxA.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
ptxA
Uniprot No.
Research Area
Others
Alternative Names
ptxA; BP3783; Pertussis toxin subunit 1; PTX S1; Islet-activating protein S1; IAP S1; NAD-dependent ADP-ribosyltransferase; EC 2.4.2.-
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Source
E.coli
Expression Region
35-269aa
Target Protein Sequence
DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA) is expressed in E.coli and includes the mature protein region from amino acids 35 to 269. This full-length protein comes with an N-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the product achieves purity levels above 90%, and it's intended for research use with consistent quality for experimental work.

Pertussis toxin subunit 1 (ptxA) forms part of the pertussis toxin complex, which appears to be central to how Bordetella pertussis causes disease. This particular subunit seems to help the toxin interfere with cellular signaling - a factor that makes it an important target for research into bacterial infection pathways and immune responses. Learning more about how it's structured and what it does may help scientists develop better treatments and vaccines.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The Bordetella pertussis PtxA is the enzymatically active S1 subunit of pertussis toxin, which requires correct folding, disulfide bond formation, and assembly with other toxin subunits (B-oligomer) for full ADP-ribosyltransferase activity and toxicity. While E. coli can express soluble proteins, it may not facilitate proper disulfide bond formation in the cytoplasm, and the His tag might sterically interfere with the active site or subunit assembly. Critically, ptxA must correctly fold to exhibit enzymatic activity, but E. coli lacks the eukaryotic chaperones and specific post-translational modifications that may be important for native conformation. Without experimental validation (e.g., enzymatic activity assays or structural analysis), the protein cannot be assumed to be correctly folded or bioactive.

1. Antibody Development and Validation Studies

This application is suitable. The recombinant ptxA can serve as an immunogen for generating antibodies against linear epitopes, even if misfolded. The His tag facilitates purification and immobilization for screening. However, antibodies produced may not recognize conformational epitopes of the native, properly folded and assembled pertussis toxin. Validate antibody specificity against native pertussis toxin or ptxA from B. pertussis culture.

2. Protein-Protein Interaction Studies

Use with caution. The His tag enables pull-down assays to identify binding partners, but if ptxA is misfolded, interactions may be non-physiological. Importantly, ptxA must correctly fold to interact with its natural partners (e.g., B-oligomer of pertussis toxin, host cell targets). Validate any identified interactions using native ptxA or full pertussis toxin.

3. Biochemical Characterization and Structural Studies

This Bordetella pertussis PtxA is suitable for basic biophysical analysis (e.g., circular dichroism for secondary structure, mass spectrometry for molecular weight). However, without confirmed bioactivity, data on enzymatic properties or functional structure are unreliable. First, validate ADP-ribosyltransferase activity before kinetic or structural studies.

4. Vaccine Research and Immunological Studies

Not recommended without folding and activity validation. An inactivated but correctly folded ptxA (toxoid) is essential for vaccine studies. A misfolded ptxA may not elicit neutralizing antibodies against the native toxin. Use properly detoxified, natively folded ptxA for vaccine development. This recombinant protein may be used for antibody production but not as an immunogen for protective studies.

Final Recommendation & Action Plan

Before using this recombinant ptxA for any functional application, validate its folding and bioactivity. First, test its enzymatic activity using an ADP-ribosyltransferase assay (e.g., with NAD and a substrate like transducin). If active, proceed with interaction or kinetic studies, but include appropriate controls (e.g., known inhibitors). If inactive, limit use to non-functional applications like antibody production (with validation against native toxin). For vaccine research, use only properly folded and inactivated ptxA. For reliable results, consider expressing ptxA in a system that supports disulfide bond formation (e.g., E. coli with a periplasmic signal sequence) or using eukaryotic expression. Always validate outcomes with native pertussis toxin controls.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B.pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD(+) into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their membrane receptors.
Gene References into Functions
  1. It has been proposed that it is the systemic activity of pertussis toxin and not pulmonary pathology that promotes mortality in critical pertussis. PMID: 28784932
Subcellular Location
Secreted. Note=The individual chains are secreted by a sec-dependent mechanism into the periplasm. Then, S1 associates with the outer membrane before it joins with the B subunit to form the secretion-competent holotoxin. The type IV secretion system ptl mediates secretion of assembled toxin through the outer membrane.
Protein Families
Bacterial exotoxin subunit A family
Database Links

KEGG: bpe:BP3783

STRING: 257313.BP3783

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*