Recombinant Bovine Decorin(DCN)

Code CSB-YP006554BO
Product Type Recombinant Protein
Size US$2959
Uniprot No. P21793
Relevance May affect the rate of fibrils formation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias Bone proteoglycan II PG-S2
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK
Research Area Others
Source Yeast
Gene Names DCN
Protein Names Recommended name: Decorin Alternative name(s): Bone proteoglycan II PG-S2
Expression Region 31-360aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 38.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May affect the rate of fibrils formation.
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Database Links

KEGG: bta:280760

STRING: 9913.ENSBTAP00000004562

UniGene: Bt.23178

Pathway TGF-beta signaling pathway

Related Products

DCN Antibodies

DCN Antibodies for Bovine

DCN Antibodies for Bos taurus (Bovine)

DCN Proteins

DCN Proteins for Bos taurus (Bovine)

DCN ELISA Kit

DCN ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.