Recombinant Bovine Apolipoprotein A-I (APOA1), partial

In Stock
Code CSB-EP001913BOa0
Abbreviation Recombinant Bovine APOA1 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
APOA1Apolipoprotein A-I; Apo-AI; ApoA-I; Apolipoprotein A1) [Cleaved into: Proapolipoprotein A-I; ProapoA-I); Truncated apolipoprotein A-I]
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
25-265aa
Target Protein Sequence
DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine Apolipoprotein A-I (APOA1) comes from E. coli expression and includes an N-terminal 6xHis-tag, which makes purification and detection much simpler. The protein represents a partial sequence—specifically amino acids 25-265 of bovine APOA1. SDS-PAGE analysis indicates purity levels above 85%. This product is strictly for research purposes and should not be used for therapeutic or diagnostic applications.

Apolipoprotein A-I (APOA1) appears to be central to lipid metabolism. It's the main protein found in high-density lipoprotein (HDL) circulating in plasma. The protein seems particularly important for reverse cholesterol transport—moving cholesterol from tissues back to the liver where it can be eliminated. Cardiovascular researchers often focus on APOA1 because of its apparent role in maintaining lipid balance and its potential effects on heart health.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Bovine APOA1 is a lipid-binding protein that requires precise folding, proper amphipathic helix formation, and specific oligomerization for its functional activity in HDL particle assembly and lipid transport. The structure of APOA1 is relatively simple, mainly composed of amphiphilic α-helices. In Escherichia coli, if the expression conditions are properly optimized, it is possible to form the correct helical structure. The N-terminal 6xHis-tag may sterically interfere with the protein's lipid-binding domains or oligomerization interfaces. For APOA1, its N-terminal is relatively flexible, so adding labels may not significantly affect its functionality, but experimental verification is needed.

1. In Vitro Lipid Binding and HDL Reconstitution Studies

This application carries a significant risk without proper folding validation. APOA1's lipid-binding and HDL reconstitution functions require precise amphipathic helix formation and tertiary structure. If correctly folded and active (verified through lipid-binding assays), the protein may be suitable for functional studies. If misfolded/inactive (unverified), lipid-binding experiments will yield biologically meaningless results due to impaired helix formation and lipid interaction capabilities.

2. Comparative Protein Structure and Function Analysis

Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and active (verified), the protein enables valid evolutionary comparisons of lipid-binding properties and structural features across species. If misfolded/inactive (unverified), comparative analyses would yield misleading evolutionary insights about APOA1 conservation and divergence.

3. Antibody Development and Immunoassay Applications

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The partial protein (25-265aa) provides comprehensive epitope coverage for generating antibodies against bovine APOA1. The high purity (>85%) ensures minimal contamination-related issues during immunization protocols.

4. Protein-Protein Interaction Studies

This application requires proper folding validation. APOA1 interactions with other lipid metabolism proteins require precise tertiary structure and native conformation. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine protein interactions in lipid transport pathways.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally limited for producing a functional version of this complex lipid-binding protein due to its inability to support proper amphipathic helix formation and oligomerization. Begin with biochemical characterization to assess folding quality through circular dichroism spectroscopy (helix content analysis) and size-exclusion chromatography (oligomerization state). Validate lipid-binding capability using phospholipid binding assays before considering functional applications. Applications 1, 2, and 4 require rigorous folding and functional validation. Application 3 (antibody development) can proceed immediately. For reliable APOA1 research requiring native functionality, use mammalian expression systems that support proper protein folding and lipid interactions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
Gene References into Functions
  1. the model of a two-step process for the transendothelial transport of apoA-I in which apoA-I is initially lipidated by ABCA1 and then further processed by ABCA1-independent mechanisms. PMID: 21209084
Subcellular Location
Secreted.
Protein Families
Apolipoprotein A1/A4/E family
Tissue Specificity
Major protein of plasma HDL, also found in chylomicrons.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*