Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
APOA1Apolipoprotein A-I; Apo-AI; ApoA-I; Apolipoprotein A1) [Cleaved into: Proapolipoprotein A-I; ProapoA-I); Truncated apolipoprotein A-I]
Species
Bos taurus (Bovine)
Expression Region
25-265aa
Target Protein Sequence
DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression vector recombined with the recombinant DNA was transfected into the yeast cells for expression. The recombinant DNA resulted from the fusion of the gene coding for the 25-265aa of the Bovine APOA1 protein and the N-terminal 6xHis tag gene. The product was purified and isolated to get the recombinant Bovine APOA1 protein with N-terminal 6xHis tag. The purity of this recombinant Bovine APOA1 protein reaches up to 90%. Under SDS-PAGE condition, this recombinant APOA1 protein showed a band with a molecular weight of about 30 kDa on the gel.
APOA1 is a gene encoding a protein named Apolipoprotein A1 (abbreviated APOA1) and belongs Apolipoprotein A1/A4/E family. APOA1 is the major component of high-density lipoprotein (HDL) and plays a central role in reverse cholesterol transport. Because HDL is able to transport cholesterol and certain fats called phospholipids through the bloodstream from the body's tissues to the liver. A study has showed that apoB and apoA1 were simple clinical indicators, and the apoB/apoA1 ratio was closely related with CHD in the overweight group. The apoB/apoA1 ratio increase indicated an increased risk of CHD and may provide some useful information in the differential diagnosis.
