Recombinant Bovine Apolipoprotein A-I(APOA1)

Code CSB-YP001913BO
Product Type Recombinant Protein
Size US$2959
Uniprot No. P15497
Relevance Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Apolipoprotein A1
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
Research Area Others
Source Yeast
Gene Names APOA1
Protein Names Recommended name: Apolipoprotein A-I Short name= Apo-AI Short name= ApoA-I Alternative name(s): Apolipoprotein A1 Cleaved into the following chain: 1. Truncated apolipoprotein A-I
Expression Region 25-265aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 29.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
Subcellular Location Secreted
Protein Families Apolipoprotein A1/A4/E family
Tissue Specificity Major protein of plasma HDL, also found in chylomicrons.
Database Links

KEGG: bta:281631

STRING: 9913.ENSBTAP00000002914

UniGene: Bt.49157

Pathway PPAR signaling pathway
Cholesterol metabolism

Related Products

APOA1 Antibodies

APOA1 Antibodies for Bos taurus (Bovine)

APOA1 Antibodies for Bovine

APOA1 Proteins

APOA1 Proteins for Bos taurus (Bovine)

APOA1 ELISA Kit

APOA1 ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.