Recombinant Bovine Inhibin alpha chain (INHA)

In Stock
Code CSB-EP011718BO
Abbreviation Recombinant Bovine INHA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
INHA
Uniprot No.
Research Area
Others
Alternative Names
INHA; Inhibin alpha chain
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
227-360aa
Target Protein Sequence
STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine INHA protein is an E.coli-expressed protein (Full Length of Mature Protein). Molecularly, this INHA protein is characterized by N-terminal 6xHis-SUMO tag, internal Bovine INHA DNA fragment (227-360aa). Standard methods for recombinant INHA protein expression comprise transfecting cells with DNA vectors that consist of specific templates and then cultures cells to translate and transcribe the INHA protein production process. Typically, these cells are lysed to extract expressed proteins for more purification. The purity of this recombinant INHA protein is 90%+ measured by SDS-PAGE.

INHA is the alpha subunit of inhibin, the inhibitor of the synthesis and secretion of pituitary gonadotropins, especially follicle-stimulating hormone (FSH). INHA has recently been involved in prostate tumorigenesis. It is overexpressed in mice, leading to aberrant reproductive function, including reduced litter and embryo size. INHA expression was declined in early-stage tumors but elevated in late-stage, metastatic prostate malignancies, implying that inhibins function as tumor inhibitors in the early stage of carcinogenesis but may serve as tumor promoters during late-stage disease.

 

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : immunization assay

Review: Ovarian follicular activity of dromedary camels (n=5) actively-immunized against recombinant bovine inhibin-A during the transition period (mid-August to mid- December)

By Anonymous

Target Background

Function
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Gene References into Functions
  1. The effects of castration and other surgical intervention on the blood levels of anti-Muellerian hormone, inhibin A, gonadotropins, and gonadotropin receptors in bull calves are reported. PMID: 27693012
  2. The expression of the components of the activin-inhibin-follistatin system is altered in bovine cystic ovarian disease. PMID: 25001504
  3. INHA gene can be used as a predictor for superovulation in Chinese Holstein cows. PMID: 20238172
  4. Inhibin has a negative autocrine or paracrine effect on the in vitro capacity of granulosa cells isolated from dominant or subordinate follicles to produce estradiol. PMID: 12697695
  5. overexpression of inhibin alpha (1-32) fragment regulated granulosa cell development and effects on subsequent oocyte maturation were both time- and stage-dependent PMID: 18456314

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*