Recombinant Bovine Inhibin alpha chain(INHA)

Code CSB-EP011718BO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P07994
Relevance Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, bryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI
Research Area Others
Source E.coli
Gene Names INHA
Expression Region 227-360aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 30.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Subcellular Location Secreted
Protein Families TGF-beta family
Database Links

KEGG: bta:281254

STRING: 9913.ENSBTAP00000013154

UniGene: Bt.36723

Related Products

INHA Antibodies

INHA Antibodies for Bos taurus (Bovine)

INHA Proteins

INHA Proteins for Bos taurus (Bovine)

INHA ELISA Kit

INHA ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.