Recombinant Bovine Interferon omega-1(IFNW1)

In Stock
Code CSB-EP011061BO
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P07352
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias IFN-omega-c1 Interferon alpha-II-1
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP
Research Area Immunology
Source E.coli
Gene Names IFNW1
Protein Names Recommended name: Interferon omega-1 Alternative name(s): IFN-omega-c1 Interferon alpha-II-1
Expression Region 24-195aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 35.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted
Protein Families Alpha/beta interferon family
Database Links

KEGG: bta:281847

STRING: 9913.ENSBTAP00000055699

UniGene: Bt.45039

Pathway Jak-STAT signaling pathway

Related Products

IFNW1 Antibodies

IFNW1 Antibodies for Bovine

IFNW1 Proteins

IFNW1 Proteins for Bos taurus (Bovine)

IFNW1 ELISA Kit

IFNW1 ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.