Recombinant Bovine Synaptosomal-associated protein 29(SNAP29)

Product Type Recombinant Protein
Uniprot No. Q0II86
Abbreviation SNAP29
Species Bos taurus (Bovine)
Gene Names SNAP29
Protein Names Recommended name: Synaptosomal-associated protein 29 Short name= SNAP-29 Alternative name(s): Soluble 29 kDa NSF attachment protein Vesicle-membrane fusion protein SNAP-29
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. This protein binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.
HGNC 11133
RGD 620225
MGI 1914724
Function SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.
Subcellular Location Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic vesicle, autophagosome membrane, Peripheral membrane protein, Cell projection, cilium membrane, Peripheral membrane protein
Protein Families SNAP-25 family
Database Links

KEGG: bta:532261

STRING: 9913.ENSBTAP00000027666

UniGene: Bt.76130

Pathway Autophagy

Product Details for Different Expression Systems

Product Name Recombinant Bovine Synaptosomal-associated protein 29(SNAP29),Yeast
Code CSB-YP603793BO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSAYPRSYNPFDEDAEDEDARPAPWSDSRDLADGPGAPADRQQALRQEVLRRAEATAAST GRSLSLMYESERIGVVSAEELVRQRGALERTEKMVDKMEQDLKTSQKHINSIKSVFGGLV NYFRSKPAETPSAQNGTLTPQPSGRLKDAINSSKEQEAQYQASHPNLRKLQDSDSIPGGA GSAVSSEAYPRNPHLRACHQRIDSNLDELSVGLGRLKDIALGIQTEIDEQDDILDRLTSK VDKLDVSITSTERKVRQL
Expression Region 1-258
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine Synaptosomal-associated protein 29(SNAP29),E.coli
Code CSB-EP603793BO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSAYPRSYNPFDEDAEDEDARPAPWSDSRDLADGPGAPADRQQALRQEVLRRAEATAAST GRSLSLMYESERIGVVSAEELVRQRGALERTEKMVDKMEQDLKTSQKHINSIKSVFGGLV NYFRSKPAETPSAQNGTLTPQPSGRLKDAINSSKEQEAQYQASHPNLRKLQDSDSIPGGA GSAVSSEAYPRNPHLRACHQRIDSNLDELSVGLGRLKDIALGIQTEIDEQDDILDRLTSK VDKLDVSITSTERKVRQL
Expression Region 1-258
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine Synaptosomal-associated protein 29(SNAP29),Baculovirus
Code CSB-BP603793BO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSAYPRSYNPFDEDAEDEDARPAPWSDSRDLADGPGAPADRQQALRQEVLRRAEATAAST GRSLSLMYESERIGVVSAEELVRQRGALERTEKMVDKMEQDLKTSQKHINSIKSVFGGLV NYFRSKPAETPSAQNGTLTPQPSGRLKDAINSSKEQEAQYQASHPNLRKLQDSDSIPGGA GSAVSSEAYPRNPHLRACHQRIDSNLDELSVGLGRLKDIALGIQTEIDEQDDILDRLTSK VDKLDVSITSTERKVRQL
Expression Region 1-258
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine Synaptosomal-associated protein 29(SNAP29),Mammalian cell
Code CSB-MP603793BO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSAYPRSYNPFDEDAEDEDARPAPWSDSRDLADGPGAPADRQQALRQEVLRRAEATAAST GRSLSLMYESERIGVVSAEELVRQRGALERTEKMVDKMEQDLKTSQKHINSIKSVFGGLV NYFRSKPAETPSAQNGTLTPQPSGRLKDAINSSKEQEAQYQASHPNLRKLQDSDSIPGGA GSAVSSEAYPRNPHLRACHQRIDSNLDELSVGLGRLKDIALGIQTEIDEQDDILDRLTSK VDKLDVSITSTERKVRQL
Expression Region 1-258
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.