Recombinant Bovine Ubiquitin-like protein ISG15 (ISG15)

In Stock
Code CSB-EP011843BO
Abbreviation Recombinant Bovine ISG15 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ISG15
Uniprot No.
Research Area
Cell Biology
Alternative Names
ISG15; G1P2; ISG17; UCRP; Ubiquitin-like protein ISG15; Interferon-stimulated gene product 17; Ubiquitin cross-reactive protein; BoUCRP
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
1-154aa
Target Protein Sequence
MGGDLTVKMLGGQEILVPLRDSMTVSELKQFIAQKINVPAFQQRLAHLDSREVLQEGVPLVLQGLRAGSTVLLVVQNCISILVRNDKGRSSPYEVQLKQTVAELKQQVCQKERVQADQFWLSFEGRPMDDEHPLEEYGLMKGCTVFMNLRLRGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.4 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Exhibits antiviral activity towards both DNA and RNA viruses. The secreted form of ISG15 can: induce natural killer cell proliferation, augment lymphokine-activated-killer (LAK) activity, induce dendritic cell maturation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL. In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy.
Gene References into Functions
  1. Data suggest that ISG15 is involved in early blastocyst/embryo development; ISG15 appears to regulate gene expression in developing blastocyst; specifically, ISG15 is required for up-regulation of IFNT expression in blastocyst development. (ISG15 = ubiquitin-like protein ISG15, interferon-stimulated gene 15 protein; IFNT = interferon-tau) PMID: 27165775
  2. ISG 15 gene expression is upregulated during 16-18 days of pregnancy and could be used as an early pregnancy marker in dairy cows, especially in heifers. PMID: 27766692
  3. ISG15, UBE1l and UBCH8 genes are significantly upregulated in the artificially inseminated pregnant cows. PMID: 27802914
  4. Data indicate that the expression profiles of ISG15, MX1, MX2, and OAS1 could be a useful diagnostic biomarker of gestation. PMID: 23384108
  5. Bovine herpesvirus 1 protein bICP0 represses the transcription of bISG15 in fetal bovine lung cells. PMID: 22160940
  6. ISG15 is an antiviral and inducible protein in bovine immunodeficiency virus infected bovin lung cells. PMID: 20569475
  7. ISG15 and conjugated proteins were expressed in corpus luteum of both cyclic and pregnant cows regardless of pregnancy status and were upregulated during early pregnancy PMID: 20172220
  8. interferon-stimulated protein(ISG15) was localized throughout the endometrium on day 18-23 of bovine pregnancy and was specifically localized to organelles and compartments of endometrial epithelial cells and stromal cells PMID: 14563704
  9. rbovISG15 is unstable over time in storage & dialysis. In vivo, conjugation of ISG15 to targeted proteins occurs inside the cell. PMID: 17223698

Show More

Hide All

Subcellular Location
Cytoplasm. Secreted.
Tissue Specificity
Expressed in endometrium and uterine flushings of pregnant cow. Also secreted. Not detected in spleen, liver, corpus luteum or muscle.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*