Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP739788CZIa2 |
| Product Type | Recombinant Protein |
| Size | US$2466 |
| Uniprot No. | Q6FXR8 |
| Relevance | Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. With ATG4, mediates the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirents and preventing excess ROS production. Participates also in mbrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent mbranes and stimulates mbrane hifusion, leading to expansion of the autophagosomal mbrane during autophagy . |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Autophagy-related ubiquitin-like modifier ATG8 |
| Species | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG |
| Research Area | Others |
| Source | E.coli |
| Gene Names | ATG8 |
| Expression Region | 1-116aa |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Mol. Weight | 29.5kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. |
| Subcellular Location | Cytoplasmic vesicle, autophagosome membrane, Lipid-anchor, Vacuole membrane, Lipid-anchor |
| Protein Families | ATG8 family |
| Database Links |
KEGG: cgr:CAGL0A04675g STRING: 284593.XP_444971.1 |
ATG8 Antibodies for Candida glabrata
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA739788HA01CZI | ATG8 Antibody | Candida glabrata | ELISA |
| CSB-PA739788HB01CZI | ATG8 Antibody, HRP conjugated | Candida glabrata | ELISA |
| CSB-PA739788HC01CZI | ATG8 Antibody, FITC conjugated | Candida glabrata | ELISA |
| CSB-PA739788HD01CZI | ATG8 Antibody, Biotin conjugated | Candida glabrata | ELISA |
ATG8 Proteins for Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP739788CZI CSB-BP739788CZI CSB-MP739788CZI |
Recombinant Candida glabrata Autophagy-related protein 8(ATG8) | Yeast Baculovirus Mammalian cell |
| CSB-EP739788CZI | Recombinant Candida glabrata Autophagy-related protein 8(ATG8) | E.coli |
Recombinant Human Mannan-binding lectin serine protease 1(MASP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Nuclear transcription factor Y subunit beta(NFYB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human GTP-binding nuclear protein Ran(RAN)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Coagulation factor XI(F11),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human N-glycosylase/DNA lyase(OGG1)
Express system: E.coli
Species: Homo sapiens (Human)
