Recombinant Chamaecyparis obtusa Pectate lyase 1

In Stock
Code CSB-EP856862CHAX
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q96385
Relevance Has pectate lyase activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP856862CHAX could indicate that this peptide derived from E.coli-expressed Chamaecyparis obtusa (Hinoki false-cypress) N/A.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP856862CHAX could indicate that this peptide derived from E.coli-expressed Chamaecyparis obtusa (Hinoki false-cypress) N/A.
Storage Buffer Tris-based buffer,50% glycerol
Species Chamaecyparis obtusa (Hinoki false-cypress)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS
Source E.coli
Expression Region 22-375aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 54.1 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has pectate lyase activity.
Protein Families Polysaccharide lyase 1 family, Amb a subfamily

Related Products

Antibodies

Antibodies for Chamaecyparis obtusa (Hinoki false-cypress)

Proteins

Proteins for Chamaecyparis obtusa (Hinoki false-cypress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.