Recombinant Chicken Interferon type B(IFNB)

In Stock
Code CSB-EP838568CH
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q90873
Lead Time 3-7 business days
Abbreviation IFNB
Relevance Has antiviral activities.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDVTFPFPETLLKSKDKKQAAITTLRILQHLFNMLSSPHTPKHWIDRTRHSLLNQIQHYIHHLEQCFVNQGTRSQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWDHVRLQARDCFRHVDTLIQWMKSRAPLTASSKRLNTQ
Research Area others
Source E.coli
Gene Names IFNB
Protein Names IFN2
Expression Region 28-203aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 24.8 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has antiviral activities.
Subcellular Location Secreted
Protein Families Alpha/beta interferon family
Database Links

KEGG: gga:554219

STRING: 9031.ENSGALP00000038687

UniGene: Gga.22865

Related Products

IFNB Antibodies

IFNB Antibodies for Gallus gallus (Chicken)

IFNB Proteins

IFNB Proteins for Gallus gallus (Chicken)

IFNB ELISA Kit

IFNB ELISA Kit for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.