Recombinant Chicken Lysozyme g, Biotinylated

In Stock
Code CSB-EP340841CH-B
Abbreviation Recombinant Chicken Lysozyme g protein, Biotinylated
MSDS
Size $466
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Species
Gallus gallus (Chicken)
Source
E.coli
Expression Region
27-211aa
Target Protein Sequence
GTGCYGSVSRIDTTGASCRTAKPEGLSYCGVRASRTIAERDLGSMNKYKVLIKRVGEALCIEPAVIAGIISRESHAGKILKNGWGDRGNGFGLMQVDKRYHKIEGTWNGEAHIRQGTRILIDMVKKIQRKFPRWTRDQQLKGGISAYNAGVGNVRSYERMDIGTLHDDYSNDVVARAQYFKQHGY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
68.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Improved algorithms for mapping protein surfaces using small organic molecules as molecular probes reproduced the binding of eight organic solvents to lysozyme as observed by NMR. PMID: 13677484
  2. The pH dependence of the initial structure of the fully reduced hen egg white lysozyme in the presence of 90% (v/v) ethanol suggests that Asp and His residues may play an important role. PMID: 14718651
  3. oxidative refolding of equilibrium intermediates of lysozyme stabilized in trifluoroethanol (TFE) and ethylene glycol PMID: 14741343
  4. Site-specific glycosylation of lysozyme in the interfacial region of lysozyme-antibody complex is more effective to reduce the antigenicity than the mutation of single amino acids. PMID: 14741362
  5. A prominent structural difference was observed in the loop region of residues Ser60-Leu75 as observed when a water molecule was replaced with a sodium atom PMID: 15039550
  6. Nonrandom folding occurs in the early stage of the folding of reduced lysozyme, a finding which provides new insight into early-stage events in the folding process of reduced lysozyme. PMID: 15122914
  7. Ni2+ quenches the fluorescence of Trp62 and Trp108 due to the binding of Ni2+ to the active site of lysozyme PMID: 15474459
  8. data describe the early events in the folding of reduced mutated W62G lysozyme in detail PMID: 15733925
  9. that expression of the lysozyme gene in undifferentiated monoblasts is low and a high level of gene expression requires both cell differentiation and lipopolysaccharide stimulation PMID: 15923188
  10. potential energy surfaces have been generated for all the oligomers PMID: 16330266
  11. The three-dimensional structure of hen egg-white lysozyme (HEWL) in a hexagonal crystal form has been determined and refined to 1.46 A resolution. PMID: 16552135

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glycosyl hydrolase 23 family
Tissue Specificity
Granulocyte compartment of myelomonocytic cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*