Recombinant Chlamydia trachomatis serovar D Large cysteine-rich periplasmic protein OmcB (omcB), partial

In Stock
Code CSB-EP315528DSB
Abbreviation Recombinant Chlamydia trachomatis omcB protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
omcB
Uniprot No.
Research Area
Microbiology
Alternative Names
omcB; omp2; omp2B; CT_443; Large cysteine-rich periplasmic protein OmcB; Large-CRP; 60 kDa cysteine-rich OMP; 60 kDa outer membrane protein; Cysteine-rich outer membrane protein; CRP
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Source
E.coli
Expression Region
41-196aa
Target Protein Sequence
LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Chlamydia trachomatis (strain D/UW-3/Cx) omcB covers amino acids 41-196. This omcB protein is expected to have a theoretical molecular weight of 33.1 kDa. The omcB protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of omcB, which enables a simple process of detecting and purifying the omcB recombinant protein in the following steps.

The Chlamydia trachomatis large cysteine-rich periplasmic protein OmcB is a crucial component of the outer membrane complex (OMC) in Chlamydia, a genus of bacteria that are obligate intracellular pathogens. OmcB is characterized by its cysteine-rich structure and is primarily located in the periplasmic space between the bacterial inner and outer membranes. As part of the OMC, OmcB likely plays a role in maintaining the structural integrity of the chlamydial outer membrane and is involved in interactions with the host cell during the infection process. Understanding the function and role of OmcB is essential for unraveling the molecular mechanisms underlying Chlamydia pathogenesis and may contribute to the development of therapeutic strategies against Chlamydia trachomatis infections.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane protein. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.
Gene References into Functions
  1. Subcellular localization of OmcB to the cytosol of infected human CD8+ T cells, as determined by conventional MHC class I antigen processing and presentation, suggests the possibility of additional cytosolic-associated function for OmcB. PMID: 15557186
Subcellular Location
Periplasm.
Database Links

KEGG: ctr:CT_443

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*