Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
omcB; omp2; omp2B; CT_443; Large cysteine-rich periplasmic protein OmcB; Large-CRP; 60 kDa cysteine-rich OMP; 60 kDa outer membrane protein; Cysteine-rich outer membrane protein; CRP
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Expression Region
41-196aa
Target Protein Sequence
LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Chlamydia trachomatis (strain D/UW-3/Cx) omcB covers amino acids 41-196. This omcB protein is expected to have a theoretical molecular weight of 33.1 kDa. The omcB protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of omcB, which enables a simple process of detecting and purifying the omcB recombinant protein in the following steps.
The Chlamydia trachomatis large cysteine-rich periplasmic protein OmcB is a crucial component of the outer membrane complex (OMC) in Chlamydia, a genus of bacteria that are obligate intracellular pathogens. OmcB is characterized by its cysteine-rich structure and is primarily located in the periplasmic space between the bacterial inner and outer membranes. As part of the OMC, OmcB likely plays a role in maintaining the structural integrity of the chlamydial outer membrane and is involved in interactions with the host cell during the infection process. Understanding the function and role of OmcB is essential for unraveling the molecular mechanisms underlying Chlamydia pathogenesis and may contribute to the development of therapeutic strategies against Chlamydia trachomatis infections.
