Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

omcB

Uniprot No.

P0CC04

Research Area

Microbiology

Alternative Names

omcB; omp2; omp2B; CT_443; Large cysteine-rich periplasmic protein OmcB; Large-CRP; 60 kDa cysteine-rich OMP; 60 kDa outer membrane protein; Cysteine-rich outer membrane protein; CRP

Species

Chlamydia trachomatis (strain D/UW-3/Cx)

Source

E.coli

Expression Region

41-196aa

Target Protein Sequence

LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

33.1kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Chlamydia trachomatis (strain D/UW-3/Cx) omcB covers amino acids 41-196. This omcB protein is expected to have a theoretical molecular weight of 33.1 kDa. The omcB protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of omcB, which enables a simple process of detecting and purifying the omcB recombinant protein in the following steps.

The Chlamydia trachomatis large cysteine-rich periplasmic protein OmcB is a crucial component of the outer membrane complex (OMC) in Chlamydia, a genus of bacteria that are obligate intracellular pathogens. OmcB is characterized by its cysteine-rich structure and is primarily located in the periplasmic space between the bacterial inner and outer membranes. As part of the OMC, OmcB likely plays a role in maintaining the structural integrity of the chlamydial outer membrane and is involved in interactions with the host cell during the infection process. Understanding the function and role of OmcB is essential for unraveling the molecular mechanisms underlying Chlamydia pathogenesis and may contribute to the development of therapeutic strategies against Chlamydia trachomatis infections.

Target Background

Function

In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane protein. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.

Gene References into Functions

Subcellular localization of OmcB to the cytosol of infected human CD8+ T cells, as determined by conventional MHC class I antigen processing and presentation, suggests the possibility of additional cytosolic-associated function for OmcB. PMID: 15557186

Subcellular Location

Periplasm.

Database Links

KEGG: ctr:CT_443

Code	CSB-EP315528DSB
Abbreviation	Recombinant Chlamydia trachomatis omcB protein, partial
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Chlamydia trachomatis serovar D Large cysteine-rich periplasmic protein OmcB (omcB), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage