Home
Protein
Recombinant Proteins
Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13)

Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13)

^{In Stock}

Code	CSB-EP816848DTL
Abbreviation	Recombinant Ciona intestinalis RPS13 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP816848DTL could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP816848DTL could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

RPS13

Uniprot No.

Q8I7D6

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

RPS13; 40S ribosomal protein S13

Species

Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)

Source

E.coli

Expression Region

2-151aa

Target Protein Sequence

GRMHAPGKGLSSSALPYRRSVPTWLKLSSEDVKEQIYKLAKKGLRPSQIGVILRDSHGSAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAMRKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

23.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The first step in producing the recombinant Ciona intestinalis (Transparent sea squirt) RPS13 protein is to construct a plasmid that encodes the Ciona intestinalis (Transparent sea squirt) RPS13 protein (2-151aa). The next is to transform this plasmid into e.coli cells, select positive e.coli cells, from which positive cells can be screened and cultured to express the protein. A N-terminal 10xHis tag and C-terminal Myc tag is fused to the protein. The recombinant Ciona intestinalis (Transparent sea squirt) RPS13 protein is purified through affinity purification from the cell lysate. Its purity is greater than 90%, determined by the SDS-PAGE analysis.